BLASTX nr result
ID: Mentha22_contig00045349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045349 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274197.1| PREDICTED: uncharacterized protein LOC100267... 55 8e-06 >ref|XP_002274197.1| PREDICTED: uncharacterized protein LOC100267992 [Vitis vinifera] Length = 976 Score = 55.5 bits (132), Expect = 8e-06 Identities = 33/111 (29%), Positives = 64/111 (57%), Gaps = 3/111 (2%) Frame = +2 Query: 23 VNSQTQSENKVLHKRKQRSVAEIMGENKSIKPVSRKLASAKEGTDAEK-STATRKRKKDG 199 ++ T SE+K+ +RKQ+S+AEIM N ++P + + KE ++ K +TA+ K+++ Sbjct: 454 LHKATGSEDKLYQRRKQKSMAEIMRGNGDVEPKNEETDMGKEDINSVKLATASEKKRRKK 513 Query: 200 NGDVKEAGSEQPSSTGKRGKKRKAEVSVSPKITNGK--EDASDGAKGGKFS 346 G+ E+ + RG+++K+ +S SP + + SDG++G + S Sbjct: 514 GGNEAESHVVNSNLASPRGRRKKSRLSGSPVTSEDRALSVESDGSEGKRES 564