BLASTX nr result
ID: Mentha22_contig00045191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045191 (719 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22606.1| hypothetical protein MIMGU_mgv11b0089651mg [Mimul... 82 2e-13 >gb|EYU22606.1| hypothetical protein MIMGU_mgv11b0089651mg [Mimulus guttatus] Length = 301 Score = 81.6 bits (200), Expect = 2e-13 Identities = 45/74 (60%), Positives = 51/74 (68%) Frame = +1 Query: 73 KCFVYEERSGGGCDIGGFDEAEAILSLLGDDFEEECFLSKKETRRLVRKPVVEKRDNGRS 252 K VYEERS D GG DEAEA+LSLL +DF+EECF KETRR V+KP+VEKR+NG Sbjct: 3 KRLVYEERS----DFGGLDEAEAVLSLLTEDFDEECFRVSKETRRFVKKPLVEKRENG-- 56 Query: 253 NVCRECGSKKNSRV 294 G KK SRV Sbjct: 57 ------GGKKKSRV 64