BLASTX nr result
ID: Mentha22_contig00045121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045121 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006424280.1| hypothetical protein CICLE_v10028253mg [Citr... 66 6e-09 ref|XP_006471355.1| PREDICTED: cytochrome P450 94A1-like [Citrus... 65 8e-09 gb|EYU36964.1| hypothetical protein MIMGU_mgv1a023150mg, partial... 65 1e-08 ref|XP_002312905.2| cytochrome P450 family protein [Populus tric... 64 2e-08 ref|XP_003606223.1| Cytochrome P450 94A1 [Medicago truncatula] g... 64 3e-08 ref|XP_003538134.1| PREDICTED: cytochrome P450 94A2-like [Glycin... 64 3e-08 ref|XP_002529058.1| cytochrome P450, putative [Ricinus communis]... 64 3e-08 ref|XP_004291623.1| PREDICTED: cytochrome P450 94A1-like [Fragar... 62 6e-08 ref|XP_004242108.1| PREDICTED: cytochrome P450 94A1-like [Solanu... 62 6e-08 ref|XP_006471356.1| PREDICTED: cytochrome P450 94A1-like [Citrus... 62 8e-08 ref|XP_006347236.1| PREDICTED: cytochrome P450 94A1-like [Solanu... 62 8e-08 ref|XP_006424281.1| hypothetical protein CICLE_v10028254mg [Citr... 62 8e-08 ref|XP_007205046.1| hypothetical protein PRUPE_ppa004592mg [Prun... 61 1e-07 ref|XP_006592314.1| PREDICTED: cytochrome P450 94A1-like [Glycin... 60 3e-07 gb|EXB38478.1| Cytochrome P450 94A1 [Morus notabilis] 58 1e-06 ref|XP_007132406.1| hypothetical protein PHAVU_011G092100g [Phas... 58 2e-06 ref|XP_007015870.1| Cytochrome P450 94A1 [Theobroma cacao] gi|50... 57 3e-06 ref|XP_006384629.1| cytochrome P450 family protein [Populus tric... 56 5e-06 emb|CBX25407.1| hypothetical_protein [Oryza brachyantha] 56 5e-06 ref|XP_006361448.1| PREDICTED: cytochrome P450 94A1-like [Solanu... 56 6e-06 >ref|XP_006424280.1| hypothetical protein CICLE_v10028253mg [Citrus clementina] gi|557526214|gb|ESR37520.1| hypothetical protein CICLE_v10028253mg [Citrus clementina] Length = 502 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+VAL+++RKF+IRV QAP+F PGLTA+VRGGLPV+V ER Sbjct: 456 EMKSVALAVVRKFNIRVSDPNQAPRFAPGLTATVRGGLPVMVQER 500 >ref|XP_006471355.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis] Length = 502 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+VAL+++RKF+IRV QAP+F PGLTA+VRGGLPV+V ER Sbjct: 456 EMKSVALAVVRKFNIRVSDPNQAPQFAPGLTATVRGGLPVMVQER 500 >gb|EYU36964.1| hypothetical protein MIMGU_mgv1a023150mg, partial [Mimulus guttatus] Length = 476 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLP 270 EMK VALSLIR+FD RV G+APKFVPGLTA+VRGGLP Sbjct: 438 EMKTVALSLIRRFDFRVADPGRAPKFVPGLTATVRGGLP 476 >ref|XP_002312905.2| cytochrome P450 family protein [Populus trichocarpa] gi|550331742|gb|EEE86860.2| cytochrome P450 family protein [Populus trichocarpa] Length = 490 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/46 (65%), Positives = 38/46 (82%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMKAVAL++IR F+ RV+ Q P+F PGLTA+VRGGLPVV+ ER+ Sbjct: 444 EMKAVALAIIRGFNTRVVDPNQVPRFSPGLTATVRGGLPVVIQERE 489 >ref|XP_003606223.1| Cytochrome P450 94A1 [Medicago truncatula] gi|84514169|gb|ABC59093.1| cytochrome P450 monooxygenase CYP94C9 [Medicago truncatula] gi|355507278|gb|AES88420.1| Cytochrome P450 94A1 [Medicago truncatula] Length = 517 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+V SL+++FD+RV+G Q P+F PGLTAS RGGLPV + ER Sbjct: 472 EMKSVVASLVKRFDVRVVGPNQEPQFAPGLTASFRGGLPVKIYER 516 >ref|XP_003538134.1| PREDICTED: cytochrome P450 94A2-like [Glycine max] Length = 506 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVV 261 EMK+V L+L+R+FDIRV+ SGQ P+F PGLTA++RGGLPV V Sbjct: 459 EMKSVVLALVRRFDIRVVQSGQEPRFEPGLTATLRGGLPVRV 500 >ref|XP_002529058.1| cytochrome P450, putative [Ricinus communis] gi|223531470|gb|EEF33302.1| cytochrome P450, putative [Ricinus communis] Length = 499 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK+VAL++IR F++RV+ Q P+F PGLTA++RGGLPVV+ ER+ Sbjct: 453 EMKSVALTMIRAFNVRVVDPNQVPRFSPGLTATMRGGLPVVIQERE 498 >ref|XP_004291623.1| PREDICTED: cytochrome P450 94A1-like [Fragaria vesca subsp. vesca] Length = 509 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK A +L+ +FDIRV GQAP+F PGLTA+VRGGLPV V ER+ Sbjct: 463 EMKCAAAALVGRFDIRVSQPGQAPRFAPGLTATVRGGLPVRVEERR 508 >ref|XP_004242108.1| PREDICTED: cytochrome P450 94A1-like [Solanum lycopersicum] Length = 514 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/47 (63%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRV-IGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK+VAL+LIR+FD +V + QAPKF+PGLTA+VRGGLP++V +R+ Sbjct: 466 EMKSVALALIRQFDFQVHLAKDQAPKFMPGLTATVRGGLPIMVQKRR 512 >ref|XP_006471356.1| PREDICTED: cytochrome P450 94A1-like [Citrus sinensis] Length = 502 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+ AL+++RKF+IRV QAP+F PGLTA+V GGLPV+V ER Sbjct: 456 EMKSAALAVVRKFNIRVSDPNQAPRFAPGLTATVSGGLPVMVRER 500 >ref|XP_006347236.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum] Length = 489 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/48 (64%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = -3 Query: 386 EMKAVALSLIRKFD--IRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK+VAL+LIR+FD + V QAPKF+PGLTA+VRGGLP++V ER+ Sbjct: 440 EMKSVALALIRQFDFQVHVATKEQAPKFMPGLTATVRGGLPIMVQERR 487 >ref|XP_006424281.1| hypothetical protein CICLE_v10028254mg [Citrus clementina] gi|557526215|gb|ESR37521.1| hypothetical protein CICLE_v10028254mg [Citrus clementina] Length = 502 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+ AL+++RKF+IRV QAP+F PGLTA+V GGLPV+V ER Sbjct: 456 EMKSAALAVVRKFNIRVSDPNQAPRFAPGLTATVSGGLPVMVQER 500 >ref|XP_007205046.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica] gi|462400688|gb|EMJ06245.1| hypothetical protein PRUPE_ppa004592mg [Prunus persica] Length = 501 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/46 (60%), Positives = 38/46 (82%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK+VA++L+R+FDI+V + P+F PGLTA+VRGGLPV + ERK Sbjct: 455 EMKSVAVALVRRFDIQVSEPDRTPRFAPGLTATVRGGLPVRIQERK 500 >ref|XP_006592314.1| PREDICTED: cytochrome P450 94A1-like [Glycine max] Length = 502 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK+V ++L+R+FDIRV Q P+F PGLTA++RGG PV V ERK Sbjct: 457 EMKSVVVALVRRFDIRVAQPDQEPRFAPGLTATLRGGFPVRVCERK 502 >gb|EXB38478.1| Cytochrome P450 94A1 [Morus notabilis] Length = 492 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+VA +LI++F+IRV G Q P+F GLTA+VRGGLPV + ER Sbjct: 447 EMKSVAHTLIKRFNIRVFGPHQEPRFAAGLTATVRGGLPVRIQER 491 >ref|XP_007132406.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris] gi|561005406|gb|ESW04400.1| hypothetical protein PHAVU_011G092100g [Phaseolus vulgaris] Length = 499 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGER 252 EMK+V ++LIR+FDIRV+ Q +F PGLTA++RGGLPV V ER Sbjct: 453 EMKSVVVALIRRFDIRVVEPDQELRFAPGLTATLRGGLPVRVFER 497 >ref|XP_007015870.1| Cytochrome P450 94A1 [Theobroma cacao] gi|508786233|gb|EOY33489.1| Cytochrome P450 94A1 [Theobroma cacao] Length = 516 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/47 (59%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGS-GQAPKFVPGLTASVRGGLPVVVGERK 249 EMK V L++I +F+IRV QAP+F PGLTA+VRGGLP++V ER+ Sbjct: 453 EMKCVVLAVISRFNIRVATDLNQAPRFAPGLTATVRGGLPILVQERE 499 >ref|XP_006384629.1| cytochrome P450 family protein [Populus trichocarpa] gi|550341397|gb|ERP62426.1| cytochrome P450 family protein [Populus trichocarpa] Length = 490 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK VAL++IR F+ V Q P+F+PG TA+VRGGLPV++ ER+ Sbjct: 444 EMKTVALAIIRGFNTVVEDPNQVPRFIPGFTATVRGGLPVLIQERE 489 >emb|CBX25407.1| hypothetical_protein [Oryza brachyantha] Length = 502 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 6/48 (12%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIG------SGQAPKFVPGLTASVRGGLPVVV 261 EMKAV+++++R FD+ V+G + AP+FVPGLTAS+RGGLPV + Sbjct: 452 EMKAVSVAVVRAFDVEVVGENGRSSAAAAPRFVPGLTASIRGGLPVKI 499 >ref|XP_006361448.1| PREDICTED: cytochrome P450 94A1-like [Solanum tuberosum] Length = 509 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -3 Query: 386 EMKAVALSLIRKFDIRVIGSGQAPKFVPGLTASVRGGLPVVVGERK 249 EMK V S+++ F+IR + G P+F PGLTA+VRGGLPVVV R+ Sbjct: 462 EMKCVVASMLQHFEIRAMAVGGEPRFDPGLTATVRGGLPVVVRRRR 507