BLASTX nr result
ID: Mentha22_contig00045012
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00045012 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Popu... 62 1e-07 ref|XP_007160332.1| hypothetical protein PHAVU_002G312700g [Phas... 60 2e-07 ref|XP_007163926.1| hypothetical protein PHAVU_L005000g, partial... 56 4e-06 >ref|XP_002322815.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] gi|222867445|gb|EEF04576.1| hypothetical protein POPTR_0016s07700g [Populus trichocarpa] Length = 63 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 225 SRPVSQNIRSGRLRTFALAGLESLCCSILPWMSE 124 S+ VSQNIRSGRLR FA AGLESLCC ILPWMSE Sbjct: 17 SKLVSQNIRSGRLRAFAFAGLESLCCFILPWMSE 50 >ref|XP_007160332.1| hypothetical protein PHAVU_002G312700g [Phaseolus vulgaris] gi|561033747|gb|ESW32326.1| hypothetical protein PHAVU_002G312700g [Phaseolus vulgaris] Length = 115 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = +3 Query: 126 QTSKEGLSSINSQARLRRKFLGGRCECFEKPALNFFIIDANKNSKI 263 QTSKEG SSI+SQ R RRK LGG CEC EK A F II+ KN++I Sbjct: 55 QTSKEGNSSISSQTRERRKLLGGHCECSEKQAFGFIIIELLKNNQI 100 >ref|XP_007163926.1| hypothetical protein PHAVU_L005000g, partial [Phaseolus vulgaris] gi|561039773|gb|ESW35920.1| hypothetical protein PHAVU_L005000g, partial [Phaseolus vulgaris] Length = 110 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/48 (58%), Positives = 31/48 (64%) Frame = +3 Query: 129 TSKEGLSSINSQARLRRKFLGGRCECFEKPALNFFIIDANKNSKIQEG 272 TSKEG SSI+SQAR RRK LGG CEC EK A I D K ++ G Sbjct: 1 TSKEGNSSISSQARERRKLLGGHCECLEKQAFGIIINDLAKEKSLKPG 48