BLASTX nr result
ID: Mentha22_contig00044841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044841 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25788.1| hypothetical protein MIMGU_mgv1a027166mg, partial... 57 3e-06 gb|EPS63303.1| hypothetical protein M569_11481, partial [Genlise... 56 5e-06 >gb|EYU25788.1| hypothetical protein MIMGU_mgv1a027166mg, partial [Mimulus guttatus] Length = 471 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 166 NIQAALINASLGRDIKATVPLNADVYHSDSGVP 264 NIQAALI A LGRD+KATVPLNADVY S++G+P Sbjct: 142 NIQAALIKAGLGRDVKATVPLNADVYQSETGLP 174 >gb|EPS63303.1| hypothetical protein M569_11481, partial [Genlisea aurea] Length = 453 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +1 Query: 166 NIQAALINASLGRDIKATVPLNADVYHSDSGVP 264 NIQAAL+ A LGR++KATVPLNADVY S++GVP Sbjct: 133 NIQAALVRAGLGREVKATVPLNADVYQSENGVP 165