BLASTX nr result
ID: Mentha22_contig00044805
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044805 (329 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44383.1| hypothetical protein MIMGU_mgv1a024495mg [Mimulus... 58 2e-06 >gb|EYU44383.1| hypothetical protein MIMGU_mgv1a024495mg [Mimulus guttatus] Length = 374 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/78 (38%), Positives = 47/78 (60%) Frame = -3 Query: 285 LEPDSVYFSDERRLMRLSLSEVHNDYGGHDNGIFDYKSKSFSACSCSNDDCPLAPAPHAE 106 L P+S+YF+D + + +YGGHDNG+F+YK+++FS+C A A ++E Sbjct: 306 LSPNSIYFTDSKEYCPRYWDK-DREYGGHDNGVFNYKTRTFSSCYFP------AAATNSE 358 Query: 105 WEYFRIMKRIDPPPLWLT 52 + +KRI PPP+W T Sbjct: 359 TQ---SIKRIVPPPIWFT 373