BLASTX nr result
ID: Mentha22_contig00044772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044772 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32124.1| hypothetical protein MIMGU_mgv1a003786mg [Mimulus... 68 1e-09 ref|XP_002320799.1| hypothetical protein POPTR_0014s08030g [Popu... 60 3e-07 ref|XP_003624035.1| hypothetical protein MTR_7g078520 [Medicago ... 57 2e-06 gb|ABN08516.1| hypothetical protein MtrDRAFT_AC157473g40v2 [Medi... 57 2e-06 ref|XP_002302588.2| hypothetical protein POPTR_0002s16130g [Popu... 57 3e-06 ref|NP_182114.1| phosphatidylinositol N-acetyglucosaminlytransfe... 56 6e-06 ref|XP_002511864.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >gb|EYU32124.1| hypothetical protein MIMGU_mgv1a003786mg [Mimulus guttatus] Length = 564 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVLGFSE 154 PHSLD+LVK DL +S WM+L SDIE+ V EMGETIF E++E+ V+ F+E Sbjct: 510 PHSLDKLVKRDLTKSGDWMNLLSDIEVIVFEMGETIFDEIIEDVVMNFAE 559 >ref|XP_002320799.1| hypothetical protein POPTR_0014s08030g [Populus trichocarpa] gi|222861572|gb|EEE99114.1| hypothetical protein POPTR_0014s08030g [Populus trichocarpa] Length = 919 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVLG 145 PH+LDQLVK D+A++ WMDL DIE + E+GE IF +L+EE + G Sbjct: 869 PHTLDQLVKKDMAKTGTWMDLRCDIETILVEIGEAIFEDLMEEAIFG 915 >ref|XP_003624035.1| hypothetical protein MTR_7g078520 [Medicago truncatula] gi|355499050|gb|AES80253.1| hypothetical protein MTR_7g078520 [Medicago truncatula] Length = 130 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVL 142 PH+L+Q+V+ D+AR+ WMDL D EI EMG+TI EL+E+T+L Sbjct: 29 PHTLEQIVRKDMARNGTWMDLRLDAEIAGFEMGDTILAELIEDTIL 74 >gb|ABN08516.1| hypothetical protein MtrDRAFT_AC157473g40v2 [Medicago truncatula] Length = 65 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVL 142 PH+L+Q+V+ D+AR+ WMDL D EI EMG+TI EL+E+T+L Sbjct: 14 PHTLEQIVRKDMARNGTWMDLRLDAEIAGFEMGDTILAELIEDTIL 59 >ref|XP_002302588.2| hypothetical protein POPTR_0002s16130g [Populus trichocarpa] gi|550345127|gb|EEE81861.2| hypothetical protein POPTR_0002s16130g [Populus trichocarpa] Length = 946 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/47 (53%), Positives = 36/47 (76%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVLG 145 PH+LDQLVK D+A++ WM+L+ DIE + E+G+ IF +L+EE V G Sbjct: 865 PHTLDQLVKKDMAKTGTWMNLQYDIETILVEIGKDIFEDLMEEIVFG 911 >ref|NP_182114.1| phosphatidylinositol N-acetyglucosaminlytransferase subunit P-like protein [Arabidopsis thaliana] gi|3386619|gb|AAC28549.1| hypothetical protein [Arabidopsis thaliana] gi|330255521|gb|AEC10615.1| phosphatidylinositol N-acetyglucosaminlytransferase subunit P-like protein [Arabidopsis thaliana] Length = 720 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETV 139 PH+LDQ+V+ DLAR+ WMDL DI VSE GE I EL+EE + Sbjct: 659 PHTLDQIVRKDLARTGNWMDLRFDIGCIVSETGEIILDELLEEII 703 >ref|XP_002511864.1| conserved hypothetical protein [Ricinus communis] gi|223549044|gb|EEF50533.1| conserved hypothetical protein [Ricinus communis] Length = 999 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/46 (52%), Positives = 34/46 (73%) Frame = +2 Query: 5 PHSLDQLVKSDLARSRKWMDLESDIEIFVSEMGETIFFELVEETVL 142 PH+L+Q+VK D+A++ WMDL D E V E+G+ IF +L+ ETVL Sbjct: 928 PHTLEQIVKKDMAKTGSWMDLRCDSETMVIEIGDAIFKDLIGETVL 973