BLASTX nr result
ID: Mentha22_contig00044718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044718 (552 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45988.1| hypothetical protein MIMGU_mgv1a008242mg [Mimulus... 61 2e-07 gb|EPS74618.1| hypothetical protein M569_00137, partial [Genlise... 55 9e-06 >gb|EYU45988.1| hypothetical protein MIMGU_mgv1a008242mg [Mimulus guttatus] Length = 380 Score = 61.2 bits (147), Expect = 2e-07 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 550 SEADGSTRPLNDIEKMFVKRETPRRRRKIL 461 SEADGSTRPLND EKMFVKRETPRRRRKIL Sbjct: 350 SEADGSTRPLNDFEKMFVKRETPRRRRKIL 379 >gb|EPS74618.1| hypothetical protein M569_00137, partial [Genlisea aurea] Length = 321 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 550 SEADGSTRPLNDIEKMFVKRETPRRRRKIL 461 SEADGSTRPL+D EKMF++RETPRRRR+IL Sbjct: 291 SEADGSTRPLDDYEKMFLRRETPRRRRRIL 320