BLASTX nr result
ID: Mentha22_contig00044524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044524 (1173 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448620.1| hypothetical protein SORBIDRAFT_06g030272 [S... 58 9e-06 >ref|XP_002448620.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor] gi|241939803|gb|EES12948.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor] Length = 482 Score = 57.8 bits (138), Expect = 9e-06 Identities = 31/79 (39%), Positives = 42/79 (53%) Frame = -1 Query: 1014 FKKAFLMWTLCSILCPTTCKRLSPKLYHLVTVAESATDYDWCSLVLNTLMDNVKIFAKSF 835 F + F++ L S LCP T S + YH V S YDWCS VL+ L+ + F Sbjct: 156 FGRLFMLLALSSFLCPNTRGACSTRYYHAVLNISSVPKYDWCSFVLDWLVSYLVKFKVHK 215 Query: 834 YSIGHSNGVGGCTYILAVS 778 + G SN +GGC +IL +S Sbjct: 216 RTTG-SNVIGGCCHILVIS 233