BLASTX nr result
ID: Mentha22_contig00044523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00044523 (431 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002448620.1| hypothetical protein SORBIDRAFT_06g030272 [S... 60 4e-07 >ref|XP_002448620.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor] gi|241939803|gb|EES12948.1| hypothetical protein SORBIDRAFT_06g030272 [Sorghum bicolor] Length = 482 Score = 59.7 bits (143), Expect = 4e-07 Identities = 32/86 (37%), Positives = 49/86 (56%) Frame = +3 Query: 141 IETFGSVVGAFDRSKREWMCEMGFGSLLHLAGIRLPRVRALCYWLMNRVDPTTRTFIAPN 320 +E F VV + ++E + ++GF LL L RLP L WL++ + TRT + PN Sbjct: 34 VEMFVDVVSNLSQQQKEVVQDLGFSGLLELCCPRLPT--NLLLWLIDHFNAATRTLMLPN 91 Query: 321 GDRFPIDKRAVHWILGIPSEGRTLLK 398 G F ++ + VH ILGIP+ G +L+ Sbjct: 92 GFNFELNPKCVHKILGIPNGGLHILR 117