BLASTX nr result
ID: Mentha22_contig00043920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043920 (481 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39631.1| hypothetical protein MIMGU_mgv1a009215mg [Mimulus... 64 2e-08 >gb|EYU39631.1| hypothetical protein MIMGU_mgv1a009215mg [Mimulus guttatus] Length = 349 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 297 MGRKGGESEPARWGPIVLLSMGLVSFCMVYIFMSTVMRPSS 419 MGRKG ESEP RWG ++LL MGLVSF +VYIFM++V+RP S Sbjct: 1 MGRKGNESEPTRWGFLILLLMGLVSFSVVYIFMTSVLRPPS 41