BLASTX nr result
ID: Mentha22_contig00043779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043779 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43416.1| hypothetical protein MIMGU_mgv1a014056mg [Mimulus... 55 8e-06 >gb|EYU43416.1| hypothetical protein MIMGU_mgv1a014056mg [Mimulus guttatus] Length = 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -1 Query: 438 EMGKEKTPVIRKKQVKKAPMKRSRPKIQRKRDKRKAAIKNTK 313 E K+ PVI+KK +KKAP +RSRPK Q KRDKRK +KN K Sbjct: 160 EKSKQNIPVIKKKLLKKAPKQRSRPKQQTKRDKRKGKVKNDK 201