BLASTX nr result
ID: Mentha22_contig00043629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043629 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22609.1| hypothetical protein MIMGU_mgv1a026408mg, partial... 57 4e-06 >gb|EYU22609.1| hypothetical protein MIMGU_mgv1a026408mg, partial [Mimulus guttatus] Length = 101 Score = 56.6 bits (135), Expect = 4e-06 Identities = 31/53 (58%), Positives = 36/53 (67%) Frame = +3 Query: 171 RLRISYRGNKGMEQCFRVSTISCSMEDINREHIEKEQSFSTDYKQEAAIDLKL 329 RLRISYR N+ +QC RVS ISC +ED EH E EQ S++ E AIDLKL Sbjct: 5 RLRISYRSNEAPKQCLRVSRISCLLEDSVEEHPETEQPSSSN--NEVAIDLKL 55