BLASTX nr result
ID: Mentha22_contig00043053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043053 (654 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003557164.1| PREDICTED: probable gluconokinase-like [Brac... 60 6e-07 gb|EPS72912.1| gluconokinase, partial [Genlisea aurea] 60 8e-07 ref|XP_002436370.1| hypothetical protein SORBIDRAFT_10g001210 [S... 60 8e-07 ref|NP_001168454.1| uncharacterized protein LOC100382228 [Zea ma... 60 8e-07 ref|XP_002276014.1| PREDICTED: probable gluconokinase [Vitis vin... 59 2e-06 ref|XP_004964351.1| PREDICTED: probable gluconokinase-like [Seta... 58 2e-06 gb|EEC79873.1| hypothetical protein OsI_21375 [Oryza sativa Indi... 58 2e-06 dbj|BAK01314.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 4e-06 ref|WP_007674779.1| gluconokinase [Caulobacter sp. AP07] gi|3980... 57 7e-06 >ref|XP_003557164.1| PREDICTED: probable gluconokinase-like [Brachypodium distachyon] Length = 208 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 108 PGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 PG+AIV+MGVSG GKSTV AMLAQ + C F++ADDY Sbjct: 9 PGLAIVIMGVSGCGKSTVAAMLAQALGCSFVEADDY 44 >gb|EPS72912.1| gluconokinase, partial [Genlisea aurea] Length = 172 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -1 Query: 105 GIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 G+A+V+MGVSG+GKST+GAMLA+ +NC F+DADDY Sbjct: 2 GMAVVIMGVSGAGKSTIGAMLARRINCSFLDADDY 36 >ref|XP_002436370.1| hypothetical protein SORBIDRAFT_10g001210 [Sorghum bicolor] gi|241914593|gb|EER87737.1| hypothetical protein SORBIDRAFT_10g001210 [Sorghum bicolor] Length = 198 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 PGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 PG+AIVVMGVSG GKSTV AMLA+ + C FI+ADDY Sbjct: 10 PGLAIVVMGVSGCGKSTVAAMLAEALGCSFIEADDY 45 >ref|NP_001168454.1| uncharacterized protein LOC100382228 [Zea mays] gi|223948399|gb|ACN28283.1| unknown [Zea mays] gi|413922037|gb|AFW61969.1| hypothetical protein ZEAMMB73_528914 [Zea mays] Length = 197 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 108 PGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 PG+AIVVMGVSG GKSTV AMLA+ + C FI+ADDY Sbjct: 10 PGLAIVVMGVSGCGKSTVAAMLAEALGCSFIEADDY 45 >ref|XP_002276014.1| PREDICTED: probable gluconokinase [Vitis vinifera] gi|297737363|emb|CBI26564.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/37 (64%), Positives = 33/37 (89%) Frame = -1 Query: 111 IPGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 + G+A+V+MGV GSGKST+G MLA+V+NC F+DADD+ Sbjct: 8 LKGMAVVIMGVCGSGKSTIGNMLAKVLNCSFLDADDF 44 >ref|XP_004964351.1| PREDICTED: probable gluconokinase-like [Setaria italica] Length = 254 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 108 PGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 PG+AIV+MGVSG GKSTV A+LA+ + C FI+ADDY Sbjct: 67 PGLAIVIMGVSGCGKSTVAALLAEALGCSFIEADDY 102 >gb|EEC79873.1| hypothetical protein OsI_21375 [Oryza sativa Indica Group] gi|222634844|gb|EEE64976.1| hypothetical protein OsJ_19890 [Oryza sativa Japonica Group] Length = 617 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -1 Query: 108 PGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 PG+AIV+MGVSG GKSTV A+LA+ + C FI+ADDY Sbjct: 431 PGLAIVIMGVSGCGKSTVAALLAETLGCSFIEADDY 466 >dbj|BAK01314.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 208 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -1 Query: 126 LFPKLIPGIAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 L P PG+AIVVMGVSG GKSTV AMLA + C F++ADD+ Sbjct: 18 LRPDPAPGLAIVVMGVSGCGKSTVAAMLADALGCGFVEADDH 59 >ref|WP_007674779.1| gluconokinase [Caulobacter sp. AP07] gi|398030446|gb|EJL23858.1| carbohydrate kinase, thermoresistant glucokinase family [Caulobacter sp. AP07] Length = 191 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 102 IAIVVMGVSGSGKSTVGAMLAQVMNCRFIDADDY 1 +AI++MGVSGSGKST+GA+LAQ +NC F+D DD+ Sbjct: 13 VAIIIMGVSGSGKSTLGAILAQALNCPFLDGDDF 46