BLASTX nr result
ID: Mentha22_contig00043015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00043015 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25790.1| hypothetical protein MIMGU_mgv1a009516mg [Mimulus... 50 2e-10 >gb|EYU25790.1| hypothetical protein MIMGU_mgv1a009516mg [Mimulus guttatus] Length = 339 Score = 50.1 bits (118), Expect(2) = 2e-10 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +1 Query: 241 VNGGASANRGNFAGALEHPSPERTMVAVDVDE 336 VNGG +ANRGNFAG ++ SP++ M+AVDVDE Sbjct: 113 VNGGGAANRGNFAGGVDQSSPQKVMLAVDVDE 144 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = +3 Query: 51 FRIKGCSSYGNVLRNCNDFKSDRIGGNEVVKARAYGPSVPQLLRVSEEV 197 FR +GC S + N+F SDR+ N+V K RA PQLLR S+EV Sbjct: 67 FRFRGCCSDNHG----NNFSSDRVSCNDVQKVRASPSWAPQLLRPSDEV 111