BLASTX nr result
ID: Mentha22_contig00042840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00042840 (365 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus... 82 1e-13 gb|EXB49972.1| hypothetical protein L484_005309 [Morus notabilis] 82 1e-13 ref|XP_006476614.1| PREDICTED: transcription factor TCP14-like [... 82 1e-13 ref|XP_006364185.1| PREDICTED: transcription factor TCP14-like [... 82 1e-13 ref|XP_006354786.1| PREDICTED: transcription factor TCP14-like [... 82 1e-13 ref|XP_007155318.1| hypothetical protein PHAVU_003G190900g [Phas... 82 1e-13 ref|XP_007138192.1| hypothetical protein PHAVU_009G188100g [Phas... 82 1e-13 ref|XP_006439606.1| hypothetical protein CICLE_v10020275mg [Citr... 82 1e-13 ref|XP_006404358.1| hypothetical protein EUTSA_v10011054mg [Eutr... 82 1e-13 ref|XP_006392342.1| hypothetical protein EUTSA_v10023507mg [Eutr... 82 1e-13 ref|XP_006377382.1| hypothetical protein POPTR_0011s05430g [Popu... 82 1e-13 gb|EPS73642.1| hypothetical protein M569_01115 [Genlisea aurea] 82 1e-13 gb|EPS61892.1| hypothetical protein M569_12901, partial [Genlise... 82 1e-13 ref|XP_007037311.1| TCP domain-like protein I [Theobroma cacao] ... 82 1e-13 ref|XP_006302348.1| hypothetical protein CARUB_v10020411mg [Caps... 82 1e-13 ref|XP_006290929.1| hypothetical protein CARUB_v10017043mg [Caps... 82 1e-13 ref|XP_004299376.1| PREDICTED: transcription factor TCP14-like [... 82 1e-13 ref|XP_007209184.1| hypothetical protein PRUPE_ppa006389mg [Prun... 82 1e-13 ref|XP_004173627.1| PREDICTED: LOW QUALITY PROTEIN: transcriptio... 82 1e-13 ref|XP_004173372.1| PREDICTED: transcription factor TCP14-like [... 82 1e-13 >gb|EYU22815.1| hypothetical protein MIMGU_mgv1a006425mg [Mimulus guttatus] Length = 444 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 126 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 163 >gb|EXB49972.1| hypothetical protein L484_005309 [Morus notabilis] Length = 431 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 111 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 148 >ref|XP_006476614.1| PREDICTED: transcription factor TCP14-like [Citrus sinensis] Length = 426 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 112 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 149 >ref|XP_006364185.1| PREDICTED: transcription factor TCP14-like [Solanum tuberosum] Length = 414 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 99 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 136 >ref|XP_006354786.1| PREDICTED: transcription factor TCP14-like [Solanum tuberosum] Length = 410 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 96 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 133 >ref|XP_007155318.1| hypothetical protein PHAVU_003G190900g [Phaseolus vulgaris] gi|561028672|gb|ESW27312.1| hypothetical protein PHAVU_003G190900g [Phaseolus vulgaris] Length = 396 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 81 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 118 >ref|XP_007138192.1| hypothetical protein PHAVU_009G188100g [Phaseolus vulgaris] gi|561011279|gb|ESW10186.1| hypothetical protein PHAVU_009G188100g [Phaseolus vulgaris] Length = 385 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 90 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 127 >ref|XP_006439606.1| hypothetical protein CICLE_v10020275mg [Citrus clementina] gi|557541868|gb|ESR52846.1| hypothetical protein CICLE_v10020275mg [Citrus clementina] Length = 424 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 110 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 147 >ref|XP_006404358.1| hypothetical protein EUTSA_v10011054mg [Eutrema salsugineum] gi|557105477|gb|ESQ45811.1| hypothetical protein EUTSA_v10011054mg [Eutrema salsugineum] Length = 486 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 122 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 159 >ref|XP_006392342.1| hypothetical protein EUTSA_v10023507mg [Eutrema salsugineum] gi|557088848|gb|ESQ29628.1| hypothetical protein EUTSA_v10023507mg [Eutrema salsugineum] Length = 394 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 56 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 93 >ref|XP_006377382.1| hypothetical protein POPTR_0011s05430g [Populus trichocarpa] gi|550327671|gb|ERP55179.1| hypothetical protein POPTR_0011s05430g [Populus trichocarpa] Length = 395 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 87 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 124 >gb|EPS73642.1| hypothetical protein M569_01115 [Genlisea aurea] Length = 343 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 64 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 101 >gb|EPS61892.1| hypothetical protein M569_12901, partial [Genlisea aurea] Length = 246 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 13 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 50 >ref|XP_007037311.1| TCP domain-like protein I [Theobroma cacao] gi|508774556|gb|EOY21812.1| TCP domain-like protein I [Theobroma cacao] Length = 399 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 88 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 125 >ref|XP_006302348.1| hypothetical protein CARUB_v10020411mg [Capsella rubella] gi|482571058|gb|EOA35246.1| hypothetical protein CARUB_v10020411mg [Capsella rubella] Length = 399 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 65 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 102 >ref|XP_006290929.1| hypothetical protein CARUB_v10017043mg [Capsella rubella] gi|482559636|gb|EOA23827.1| hypothetical protein CARUB_v10017043mg [Capsella rubella] Length = 512 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 123 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 160 >ref|XP_004299376.1| PREDICTED: transcription factor TCP14-like [Fragaria vesca subsp. vesca] Length = 423 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 98 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 135 >ref|XP_007209184.1| hypothetical protein PRUPE_ppa006389mg [Prunus persica] gi|462404919|gb|EMJ10383.1| hypothetical protein PRUPE_ppa006389mg [Prunus persica] Length = 414 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 95 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 132 >ref|XP_004173627.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor TCP15-like [Cucumis sativus] Length = 367 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 75 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 112 >ref|XP_004173372.1| PREDICTED: transcription factor TCP14-like [Cucumis sativus] Length = 421 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +2 Query: 251 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 364 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET Sbjct: 97 DRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGET 134