BLASTX nr result
ID: Mentha22_contig00041971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041971 (767 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73380.1| hypothetical protein M569_01382 [Genlisea aurea] 89 2e-15 >gb|EPS73380.1| hypothetical protein M569_01382 [Genlisea aurea] Length = 165 Score = 88.6 bits (218), Expect = 2e-15 Identities = 43/87 (49%), Positives = 63/87 (72%) Frame = -1 Query: 629 MKQQLLFALKFLTLSGVYMFTRSRTPANKLKTPEKSLAVLFILENLKRIFIDNRRLIKDS 450 M+QQL A KF+ ++G+Y+FTRSRTP + + PE SL V+ +L NL+ +I N RLI + Sbjct: 1 MRQQLQLAFKFVAIAGIYLFTRSRTPPRERRNPEHSLLVIILLGNLRNSWIQNGRLIAGA 60 Query: 449 KTEVEILDNDVRLFKAFLKDCENRRTR 369 +T+ +L+ D+ LFKAFL+D + RRTR Sbjct: 61 ETDAYLLEKDIVLFKAFLED-DRRRTR 86