BLASTX nr result
ID: Mentha22_contig00041849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041849 (426 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum] 58 1e-06 gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Mimulus... 57 3e-06 ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-li... 55 8e-06 >gb|AAD29679.1|AF133209_1 CLC-Nt2 protein [Nicotiana tabacum] Length = 786 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 424 AAGVNPVVGILTRQDLRAHNILSAFPQLEKS 332 AAGV+PVVGILTRQDLRAHNILS FP LEKS Sbjct: 749 AAGVSPVVGILTRQDLRAHNILSVFPHLEKS 779 >gb|EYU45399.1| hypothetical protein MIMGU_mgv1a001597mg [Mimulus guttatus] Length = 788 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -3 Query: 424 AAGVNPVVGILTRQDLRAHNILSAFPQLEKS 332 AAGV+PVVGILTRQDL AHNILSAFP LEKS Sbjct: 751 AAGVSPVVGILTRQDLIAHNILSAFPHLEKS 781 >ref|XP_006357190.1| PREDICTED: chloride channel protein CLC-b-like [Solanum tuberosum] Length = 784 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 424 AAGVNPVVGILTRQDLRAHNILSAFPQLEKS 332 AAGV+PVVGILTRQDLRAHNILS FP L KS Sbjct: 748 AAGVSPVVGILTRQDLRAHNILSVFPHLVKS 778