BLASTX nr result
ID: Mentha22_contig00041787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041787 (364 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS71378.1| hypothetical protein M569_03381, partial [Genlise... 60 2e-07 >gb|EPS71378.1| hypothetical protein M569_03381, partial [Genlisea aurea] Length = 169 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 362 GDPKSYEECVAMIRVFDSDGKGEIGYAQFQQMM 264 GDPKSY++CVAMI VFDSDGKGE+GY +F +MM Sbjct: 136 GDPKSYDDCVAMIGVFDSDGKGELGYGEFHRMM 168