BLASTX nr result
ID: Mentha22_contig00041637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00041637 (538 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34529.1| hypothetical protein MIMGU_mgv1a017792mg [Mimulus... 68 2e-09 >gb|EYU34529.1| hypothetical protein MIMGU_mgv1a017792mg [Mimulus guttatus] Length = 273 Score = 67.8 bits (164), Expect = 2e-09 Identities = 40/76 (52%), Positives = 51/76 (67%), Gaps = 4/76 (5%) Frame = +2 Query: 101 LIKVSPPSDAIIAY--LNHTIQELKEKIHR-KEGHPIERMRI-HANGITDHPDHKTLREC 268 L+K+ PP AI L+ TIQ LKEKIH EG PI R+ + HANGI H DHKT+REC Sbjct: 96 LLKMPPPKSAITVEMDLDETIQRLKEKIHECMEGVPIARLAVVHANGIELH-DHKTVREC 154 Query: 269 RISDDTEVSVELLGSP 316 +SD +E++V + SP Sbjct: 155 ELSDKSELNVGIRSSP 170