BLASTX nr result
ID: Mentha22_contig00040766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040766 (330 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45834.1| hypothetical protein MIMGU_mgv1a011501mg [Mimulus... 67 2e-09 gb|EYU21519.1| hypothetical protein MIMGU_mgv1a010030mg [Mimulus... 62 8e-08 ref|XP_003530078.2| PREDICTED: auxin-responsive protein IAA26-li... 62 1e-07 ref|XP_007150599.1| hypothetical protein PHAVU_005G165600g [Phas... 62 1e-07 ref|NP_001236774.1| uncharacterized protein LOC100305794 [Glycin... 62 1e-07 ref|XP_003546582.1| PREDICTED: auxin-responsive protein IAA26-li... 61 2e-07 ref|XP_003543621.1| PREDICTED: auxin-responsive protein IAA26-li... 61 2e-07 ref|XP_004486788.1| PREDICTED: auxin-responsive protein IAA26-li... 60 3e-07 ref|NP_001266088.1| IAA26 [Solanum lycopersicum] gi|365818553|gb... 59 7e-07 ref|XP_007135630.1| hypothetical protein PHAVU_010G145000g [Phas... 58 1e-06 ref|XP_003597669.1| Auxin-responsive protein IAA18 [Medicago tru... 58 2e-06 ref|XP_007150600.1| hypothetical protein PHAVU_005G165600g [Phas... 57 2e-06 ref|XP_003627047.1| Auxin-responsive protein IAA18 [Medicago tru... 57 2e-06 ref|XP_004302853.1| PREDICTED: auxin-responsive protein IAA26-li... 56 5e-06 ref|XP_004510314.1| PREDICTED: auxin-responsive protein IAA26-li... 56 6e-06 ref|XP_007024319.1| Phytochrome-associated protein 1, putative [... 55 8e-06 >gb|EYU45834.1| hypothetical protein MIMGU_mgv1a011501mg [Mimulus guttatus] Length = 279 Score = 67.4 bits (163), Expect = 2e-09 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKSSELPT SRG KQ K Sbjct: 240 VGDVPWHMFVSTVKRLRVLKSSELPTLSRGSKQGK 274 >gb|EYU21519.1| hypothetical protein MIMGU_mgv1a010030mg [Mimulus guttatus] Length = 324 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGK 98 VGDVPWHMFVSTVKRLRVLKSSELP SRG K Sbjct: 286 VGDVPWHMFVSTVKRLRVLKSSELPKLSRGSK 317 >ref|XP_003530078.2| PREDICTED: auxin-responsive protein IAA26-like [Glycine max] Length = 317 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTVKRLRVLKSS+LP F+ G KQ Sbjct: 284 VGDVPWHMFVSTVKRLRVLKSSDLPAFTLGSKQ 316 >ref|XP_007150599.1| hypothetical protein PHAVU_005G165600g [Phaseolus vulgaris] gi|561023863|gb|ESW22593.1| hypothetical protein PHAVU_005G165600g [Phaseolus vulgaris] Length = 343 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKSSEL F+ G KQ K Sbjct: 301 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGSKQEK 335 >ref|NP_001236774.1| uncharacterized protein LOC100305794 [Glycine max] gi|255626619|gb|ACU13654.1| unknown [Glycine max] Length = 217 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTVKRLRVLKSS+LP F+ G KQ Sbjct: 184 VGDVPWHMFVSTVKRLRVLKSSDLPAFTLGSKQ 216 >ref|XP_003546582.1| PREDICTED: auxin-responsive protein IAA26-like isoform X1 [Glycine max] gi|571514902|ref|XP_006597173.1| PREDICTED: auxin-responsive protein IAA26-like isoform X2 [Glycine max] Length = 320 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKSSEL F+ G KQ K Sbjct: 278 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGSKQDK 312 >ref|XP_003543621.1| PREDICTED: auxin-responsive protein IAA26-like isoform X1 [Glycine max] gi|571503497|ref|XP_006595122.1| PREDICTED: auxin-responsive protein IAA26-like isoform X2 [Glycine max] Length = 346 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKSSEL F+ G KQ K Sbjct: 304 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGSKQDK 338 >ref|XP_004486788.1| PREDICTED: auxin-responsive protein IAA26-like [Cicer arietinum] Length = 287 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKSSEL F+ G KQ K Sbjct: 250 VGDVPWHMFVSTVKRLRVLKSSELSAFTLGTKQDK 284 >ref|NP_001266088.1| IAA26 [Solanum lycopersicum] gi|365818553|gb|AEX00365.1| IAA26 [Solanum lycopersicum] Length = 287 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTVKRLRVLKSSEL T +R KQ Sbjct: 253 VGDVPWHMFVSTVKRLRVLKSSELSTLTRATKQ 285 >ref|XP_007135630.1| hypothetical protein PHAVU_010G145000g [Phaseolus vulgaris] gi|561008675|gb|ESW07624.1| hypothetical protein PHAVU_010G145000g [Phaseolus vulgaris] Length = 314 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTV+RLRVLKSS+LP F+ KQ Sbjct: 281 VGDVPWHMFVSTVRRLRVLKSSDLPAFTLSSKQ 313 >ref|XP_003597669.1| Auxin-responsive protein IAA18 [Medicago truncatula] gi|355486717|gb|AES67920.1| Auxin-responsive protein IAA18 [Medicago truncatula] Length = 269 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQRK 107 VGDVPWHMFVSTVKRLRVLKS+EL F+ G +Q K Sbjct: 232 VGDVPWHMFVSTVKRLRVLKSTELSAFTLGTRQDK 266 >ref|XP_007150600.1| hypothetical protein PHAVU_005G165600g [Phaseolus vulgaris] gi|561023864|gb|ESW22594.1| hypothetical protein PHAVU_005G165600g [Phaseolus vulgaris] Length = 342 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQR 104 VGDVPWHMFVSTVKRLRVLKSSEL F+R +++ Sbjct: 301 VGDVPWHMFVSTVKRLRVLKSSELSAFTRSKQEK 334 >ref|XP_003627047.1| Auxin-responsive protein IAA18 [Medicago truncatula] gi|355521069|gb|AET01523.1| Auxin-responsive protein IAA18 [Medicago truncatula] Length = 271 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTVKRLRV KSS+LP F+ G K+ Sbjct: 238 VGDVPWHMFVSTVKRLRVSKSSDLPAFNIGSKK 270 >ref|XP_004302853.1| PREDICTED: auxin-responsive protein IAA26-like [Fragaria vesca subsp. vesca] Length = 335 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/37 (78%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFS-RGGKQRKH 110 VGDVPWHMFVSTVKRLRVLKSSEL S R GK+ K+ Sbjct: 299 VGDVPWHMFVSTVKRLRVLKSSELSALSIRTGKELKN 335 >ref|XP_004510314.1| PREDICTED: auxin-responsive protein IAA26-like [Cicer arietinum] Length = 238 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQ 101 VGDVPWHMFVSTVKRLRV K+S++P F+ G K+ Sbjct: 205 VGDVPWHMFVSTVKRLRVSKTSDIPAFNLGSKK 237 >ref|XP_007024319.1| Phytochrome-associated protein 1, putative [Theobroma cacao] gi|508779685|gb|EOY26941.1| Phytochrome-associated protein 1, putative [Theobroma cacao] Length = 353 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 VGDVPWHMFVSTVKRLRVLKSSELPTFSRGGKQR 104 VGDVPWHMFVSTVKRLRVLKSSEL S G ++ Sbjct: 315 VGDVPWHMFVSTVKRLRVLKSSELSALSLGSSKQ 348