BLASTX nr result
ID: Mentha22_contig00040704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040704 (350 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21324.1| hypothetical protein MIMGU_mgv1a009646mg [Mimulus... 55 8e-06 ref|XP_007217295.1| hypothetical protein PRUPE_ppa018297mg [Prun... 55 1e-05 >gb|EYU21324.1| hypothetical protein MIMGU_mgv1a009646mg [Mimulus guttatus] Length = 335 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 350 RKLGPKSSLEIIRDTGHAVNFDSPDSLNDLIKGFIL 243 R LGP+ LE+I D+GHA N DSP+SLN LIKGFIL Sbjct: 296 RDLGPRCRLEVIEDSGHAANIDSPESLNALIKGFIL 331 >ref|XP_007217295.1| hypothetical protein PRUPE_ppa018297mg [Prunus persica] gi|462413445|gb|EMJ18494.1| hypothetical protein PRUPE_ppa018297mg [Prunus persica] Length = 330 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 350 RKLGPKSSLEIIRDTGHAVNFDSPDSLNDLIKGFIL 243 R+LGPKS +EII DTGHAVN DSP SLN LI F+L Sbjct: 292 RQLGPKSKVEIIEDTGHAVNMDSPISLNALITSFVL 327