BLASTX nr result
ID: Mentha22_contig00040257
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040257 (572 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007015750.1| F-box and associated interaction domains-con... 56 6e-06 >ref|XP_007015750.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590586605|ref|XP_007015751.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786113|gb|EOY33369.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508786114|gb|EOY33370.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 387 Score = 56.2 bits (134), Expect = 6e-06 Identities = 46/139 (33%), Positives = 67/139 (48%), Gaps = 6/139 (4%) Frame = +2 Query: 119 HYLSVLSPR---DFSVIYDFDLPFEKNQNY-DVAGNSCHGLLHFHNFGGQSVVCNLTIXX 286 HY S LS +FSV + LPF +N Y V C+GLL H+ G++ + N + Sbjct: 75 HYFSALSTEKGENFSVTENIHLPFFENCWYAPVVSGPCNGLLCLHD-AGKAALWNPSTRE 133 Query: 287 XXXXXXXXXXSDP--DDAIFYGVGFGYDASSNDYKVIRTYVEHFSSDVGDEEGIDCYEGS 460 P D F +GFG+D+ ++DYKV+R +F D +EEG Sbjct: 134 FKILPRSSVNRPPSVDSTSFGCLGFGFDSITDDYKVVRFVTNYF--DENEEEG--GLADW 189 Query: 461 EEHTQVYSLKNGDDGWREI 517 ++YSLK+ D W+EI Sbjct: 190 IHQVELYSLKS--DSWKEI 206