BLASTX nr result
ID: Mentha22_contig00040086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00040086 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523528.1| conserved hypothetical protein [Ricinus comm... 56 9e-10 >ref|XP_002523528.1| conserved hypothetical protein [Ricinus communis] gi|223537235|gb|EEF38867.1| conserved hypothetical protein [Ricinus communis] Length = 472 Score = 56.2 bits (134), Expect(2) = 9e-10 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 5/50 (10%) Frame = +3 Query: 6 RYVHLRFSHSNRYWQRN-----VNNRSVVAISTKPEEDTSNPSCTLFEPV 140 ++VHLRFSH+N+YW R+ ++ V A S +PEEDTS SCTLFEP+ Sbjct: 57 KFVHLRFSHTNKYWGRSGPGFTQDDYWVSATSDQPEEDTSKWSCTLFEPI 106 Score = 32.3 bits (72), Expect(2) = 9e-10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Frame = +1 Query: 160 VQSGGRLLTEDPISF--PASSYWVDPNPHPQHGYL--TYVNWEDLVKLPERVAFKGDND 324 VQ+GGR+ T+ PI P S + + YL T+ + L LP+RVAF+G ND Sbjct: 117 VQTGGRVRTDGPIGATGPVSRLLLYFRNYDNVPYLDFTFFDLGTLCILPKRVAFRGYND 175