BLASTX nr result
ID: Mentha22_contig00038504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00038504 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21430.1| hypothetical protein MIMGU_mgv1a009886mg [Mimulus... 58 1e-06 >gb|EYU21430.1| hypothetical protein MIMGU_mgv1a009886mg [Mimulus guttatus] Length = 328 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -2 Query: 210 DGYAPPTAEGEKSSEMQE-QPLAPVDPIIDQGPSKRMK 100 DGYAP + EGEKSS+ Q +PL PVDPIIDQGPSKR+K Sbjct: 288 DGYAPLSTEGEKSSDSQSAEPLPPVDPIIDQGPSKRIK 325