BLASTX nr result
ID: Mentha22_contig00037546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037546 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS67684.1| hypothetical protein M569_07090, partial [Genlise... 62 8e-08 >gb|EPS67684.1| hypothetical protein M569_07090, partial [Genlisea aurea] Length = 205 Score = 62.0 bits (149), Expect = 8e-08 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = +3 Query: 69 KQNQGLTVKGSVHSRPSKVFCNAASLEEEFSAIQSKNFSKDEESLDSETLPEETTVERLP 248 K N L + S + R +V C ++LEEEF+A+QSK F K+ S D + EE T +LP Sbjct: 26 KSNGILIGRSSANHRRWRVLCKPSNLEEEFAALQSKKFFKNVNS-DPDDSSEEAT-PKLP 83 Query: 249 TSEELKALLADSQRT 293 +SEELKALLADS+R+ Sbjct: 84 SSEELKALLADSERS 98