BLASTX nr result
ID: Mentha22_contig00037209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00037209 (336 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30517.1| hypothetical protein MIMGU_mgv1a0020012mg, partia... 61 2e-07 >gb|EYU30517.1| hypothetical protein MIMGU_mgv1a0020012mg, partial [Mimulus guttatus] Length = 453 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/38 (78%), Positives = 31/38 (81%) Frame = -1 Query: 336 FMANAFRFRFLAVRDAKSTSRFQIGSIDLYSKTSTDPS 223 F+ANAFRFRF AVRD KSTSRFQIGSIDLY K PS Sbjct: 414 FLANAFRFRFQAVRDVKSTSRFQIGSIDLYMKADGVPS 451