BLASTX nr result
ID: Mentha22_contig00036773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036773 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25150.1| hypothetical protein MIMGU_mgv1a009601mg [Mimulus... 67 2e-09 >gb|EYU25150.1| hypothetical protein MIMGU_mgv1a009601mg [Mimulus guttatus] Length = 337 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = +1 Query: 1 INLASRDFEDHRRVLSAYEIEPEKDNTFDVTDSILCSQSEGA 126 INLAS DFEDHRR+LS+YEI+ EKDN FDVTDSIL S+SE A Sbjct: 295 INLASPDFEDHRRLLSSYEIDTEKDNDFDVTDSILDSESEDA 336