BLASTX nr result
ID: Mentha22_contig00036587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036587 (554 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20206.1| hypothetical protein MIMGU_mgv1a007075mg [Mimulus... 88 1e-15 ref|XP_002299143.2| hypothetical protein POPTR_0001s00860g [Popu... 88 1e-15 ref|XP_004307006.1| PREDICTED: autophagy-related protein 3-like ... 88 1e-15 ref|XP_007218722.1| hypothetical protein PRUPE_ppa009040mg [Prun... 88 1e-15 ref|XP_002303487.1| hypothetical protein POPTR_0003s10620g [Popu... 88 1e-15 ref|XP_002276342.1| PREDICTED: autophagy-related protein 3 [Viti... 88 1e-15 ref|XP_007052229.1| Autophagy 3 (APG3) isoform 1 [Theobroma caca... 87 3e-15 gb|AAR15430.1| autophagocytosis protein [Sisymbrium irio] 87 3e-15 gb|EXB37601.1| hypothetical protein L484_021806 [Morus notabilis] 87 4e-15 ref|NP_568934.1| autophagy-related protein 3 [Arabidopsis thalia... 86 6e-15 ref|XP_007131351.1| hypothetical protein PHAVU_011G006500g [Phas... 86 6e-15 ref|XP_007131350.1| hypothetical protein PHAVU_011G006500g [Phas... 86 6e-15 ref|XP_006399245.1| hypothetical protein EUTSA_v10014155mg [Eutr... 86 6e-15 ref|XP_006394498.1| hypothetical protein EUTSA_v10004633mg [Eutr... 86 6e-15 ref|XP_004514519.1| PREDICTED: autophagy-related protein 3-like ... 86 6e-15 ref|XP_006282346.1| hypothetical protein CARUB_v10028643mg [Caps... 86 6e-15 pdb|3VX8|B Chain B, Crystal Structure Of Arabidopsis Thaliana At... 86 6e-15 gb|AFK34948.1| unknown [Medicago truncatula] 86 6e-15 ref|XP_002866439.1| autophagy 3 [Arabidopsis lyrata subsp. lyrat... 86 6e-15 dbj|BAI22685.1| autophagy protein ATG3 [Glycine max] 86 6e-15 >gb|EYU20206.1| hypothetical protein MIMGU_mgv1a007075mg [Mimulus guttatus] Length = 420 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 378 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 420 >ref|XP_002299143.2| hypothetical protein POPTR_0001s00860g [Populus trichocarpa] gi|550346141|gb|EEE83948.2| hypothetical protein POPTR_0001s00860g [Populus trichocarpa] Length = 315 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 273 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 315 >ref|XP_004307006.1| PREDICTED: autophagy-related protein 3-like [Fragaria vesca subsp. vesca] Length = 311 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 269 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 311 >ref|XP_007218722.1| hypothetical protein PRUPE_ppa009040mg [Prunus persica] gi|462415184|gb|EMJ19921.1| hypothetical protein PRUPE_ppa009040mg [Prunus persica] Length = 308 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 266 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 308 >ref|XP_002303487.1| hypothetical protein POPTR_0003s10620g [Populus trichocarpa] gi|222840919|gb|EEE78466.1| hypothetical protein POPTR_0003s10620g [Populus trichocarpa] Length = 315 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 273 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 315 >ref|XP_002276342.1| PREDICTED: autophagy-related protein 3 [Vitis vinifera] gi|297734579|emb|CBI16630.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 88.2 bits (217), Expect = 1e-15 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS Sbjct: 272 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 314 >ref|XP_007052229.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] gi|590723600|ref|XP_007052230.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] gi|590723604|ref|XP_007052231.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] gi|508704490|gb|EOX96386.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] gi|508704491|gb|EOX96387.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] gi|508704492|gb|EOX96388.1| Autophagy 3 (APG3) isoform 1 [Theobroma cacao] Length = 313 Score = 87.0 bits (214), Expect = 3e-15 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSN 313 >gb|AAR15430.1| autophagocytosis protein [Sisymbrium irio] Length = 312 Score = 87.0 bits (214), Expect = 3e-15 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSSS Sbjct: 267 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSS 309 >gb|EXB37601.1| hypothetical protein L484_021806 [Morus notabilis] Length = 314 Score = 86.7 bits (213), Expect = 4e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSS 128 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSS Sbjct: 272 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSS 313 >ref|NP_568934.1| autophagy-related protein 3 [Arabidopsis thaliana] gi|147742948|sp|Q0WWQ1.2|ATG3_ARATH RecName: Full=Autophagy-related protein 3; AltName: Full=Autophagy-related E2-like conjugation enzyme ATG3; Short=AtAPG3; Short=Protein autophagy 3 gi|19912141|dbj|BAB88382.1| autophagy 3 [Arabidopsis thaliana] gi|89000923|gb|ABD59051.1| At5g61500 [Arabidopsis thaliana] gi|332010093|gb|AED97476.1| autophagy-related protein 3 [Arabidopsis thaliana] Length = 313 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 313 >ref|XP_007131351.1| hypothetical protein PHAVU_011G006500g [Phaseolus vulgaris] gi|561004351|gb|ESW03345.1| hypothetical protein PHAVU_011G006500g [Phaseolus vulgaris] Length = 314 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 272 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSN 314 >ref|XP_007131350.1| hypothetical protein PHAVU_011G006500g [Phaseolus vulgaris] gi|561004350|gb|ESW03344.1| hypothetical protein PHAVU_011G006500g [Phaseolus vulgaris] Length = 310 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 268 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSN 310 >ref|XP_006399245.1| hypothetical protein EUTSA_v10014155mg [Eutrema salsugineum] gi|557100335|gb|ESQ40698.1| hypothetical protein EUTSA_v10014155mg [Eutrema salsugineum] Length = 313 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 313 >ref|XP_006394498.1| hypothetical protein EUTSA_v10004633mg [Eutrema salsugineum] gi|557091137|gb|ESQ31784.1| hypothetical protein EUTSA_v10004633mg [Eutrema salsugineum] Length = 314 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 272 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 314 >ref|XP_004514519.1| PREDICTED: autophagy-related protein 3-like isoform X1 [Cicer arietinum] gi|502169031|ref|XP_004514520.1| PREDICTED: autophagy-related protein 3-like isoform X2 [Cicer arietinum] Length = 310 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 268 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSN 310 >ref|XP_006282346.1| hypothetical protein CARUB_v10028643mg [Capsella rubella] gi|482551050|gb|EOA15244.1| hypothetical protein CARUB_v10028643mg [Capsella rubella] Length = 313 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 313 >pdb|3VX8|B Chain B, Crystal Structure Of Arabidopsis Thaliana Atg7ntd-Atg3 Complex gi|414145391|pdb|3VX8|C Chain C, Crystal Structure Of Arabidopsis Thaliana Atg7ntd-Atg3 Complex Length = 292 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 250 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 292 >gb|AFK34948.1| unknown [Medicago truncatula] Length = 310 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 268 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSN 310 >ref|XP_002866439.1| autophagy 3 [Arabidopsis lyrata subsp. lyrata] gi|297312274|gb|EFH42698.1| autophagy 3 [Arabidopsis lyrata subsp. lyrata] Length = 313 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSST 313 >dbj|BAI22685.1| autophagy protein ATG3 [Glycine max] Length = 313 Score = 85.9 bits (211), Expect = 6e-15 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = +3 Query: 3 LMSRGVEPEVDKYLFLFLKFVASVIPTIEYDYTMDFDLGSSSS 131 LMSRGVEPEVDKYLFLFLKF+ASVIPTIEYDYTMDFDLGSSS+ Sbjct: 271 LMSRGVEPEVDKYLFLFLKFMASVIPTIEYDYTMDFDLGSSSN 313