BLASTX nr result
ID: Mentha22_contig00036293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00036293 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Mimulus... 87 3e-15 ref|XP_006280741.1| hypothetical protein CARUB_v10026710mg [Caps... 84 2e-14 dbj|BAB10547.1| unnamed protein product [Arabidopsis thaliana] 84 2e-14 ref|NP_001190603.1| protein EMBRYO DEFECTIVE 2759 [Arabidopsis t... 84 2e-14 ref|XP_002263464.1| PREDICTED: uncharacterized protein LOC100265... 84 2e-14 emb|CAN66425.1| hypothetical protein VITISV_007985 [Vitis vinifera] 84 2e-14 ref|NP_201110.2| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thal... 84 2e-14 gb|EPS63513.1| hypothetical protein M569_11269, partial [Genlise... 83 3e-14 ref|XP_007036303.1| Embryo defective 2759 isoform 2, partial [Th... 83 4e-14 ref|XP_007036302.1| Embryo defective 2759, putative isoform 1 [T... 83 4e-14 ref|XP_002864832.1| EMB2759 [Arabidopsis lyrata subsp. lyrata] g... 83 4e-14 gb|EXB93587.1| hypothetical protein L484_014579 [Morus notabilis] 82 6e-14 ref|XP_006394322.1| hypothetical protein EUTSA_v10004512mg [Eutr... 82 1e-13 ref|NP_001242677.1| uncharacterized protein LOC100798149 [Glycin... 81 1e-13 ref|XP_006344428.1| PREDICTED: uncharacterized protein LOC102597... 80 2e-13 ref|XP_004236230.1| PREDICTED: uncharacterized protein LOC101257... 80 2e-13 dbj|BAB82451.1| PBng110 [Vigna radiata] 80 3e-13 ref|XP_007155447.1| hypothetical protein PHAVU_003G202200g [Phas... 80 3e-13 gb|EYU22149.1| hypothetical protein MIMGU_mgv1a009494mg [Mimulus... 80 4e-13 ref|XP_006581918.1| PREDICTED: uncharacterized protein LOC100802... 79 6e-13 >gb|EYU17699.1| hypothetical protein MIMGU_mgv1a009574mg [Mimulus guttatus] Length = 337 Score = 86.7 bits (213), Expect = 3e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T ++KD+QGW VE+YLDFVESIWPYYCRTIRFLKRANLI Sbjct: 293 DYKELTKNRMKDLQGWFVERYLDFVESIWPYYCRTIRFLKRANLI 337 >ref|XP_006280741.1| hypothetical protein CARUB_v10026710mg [Capsella rubella] gi|482549445|gb|EOA13639.1| hypothetical protein CARUB_v10026710mg [Capsella rubella] Length = 345 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T KLK Q W++EKYLDFVES+WPYYCRTIRFLKRANLI Sbjct: 301 DYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLKRANLI 345 >dbj|BAB10547.1| unnamed protein product [Arabidopsis thaliana] Length = 216 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T KLK Q W++EKYLDFVES+WPYYCRTIRFLKRANLI Sbjct: 172 DYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLKRANLI 216 >ref|NP_001190603.1| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana] gi|332010309|gb|AED97692.1| embryo defective 2759 protein [Arabidopsis thaliana] Length = 339 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T KLK Q W++EKYLDFVES+WPYYCRTIRFLKRANLI Sbjct: 295 DYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLKRANLI 339 >ref|XP_002263464.1| PREDICTED: uncharacterized protein LOC100265372 [Vitis vinifera] gi|297733749|emb|CBI14996.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DY+E++ KLKD+Q WL+E+YLDFVESIWPYYCRTIRFLKRANLI Sbjct: 298 LDYRELSRRKLKDLQEWLLERYLDFVESIWPYYCRTIRFLKRANLI 343 >emb|CAN66425.1| hypothetical protein VITISV_007985 [Vitis vinifera] Length = 307 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DY+E++ KLKD+Q WL+E+YLDFVESIWPYYCRTIRFLKRANLI Sbjct: 262 LDYRELSRRKLKDLQEWLLERYLDFVESIWPYYCRTIRFLKRANLI 307 >ref|NP_201110.2| protein EMBRYO DEFECTIVE 2759 [Arabidopsis thaliana] gi|40823245|gb|AAR92269.1| At5g63050 [Arabidopsis thaliana] gi|45752714|gb|AAS76255.1| At5g63050 [Arabidopsis thaliana] gi|332010308|gb|AED97691.1| embryo defective 2759 protein [Arabidopsis thaliana] Length = 345 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T KLK Q W++EKYLDFVES+WPYYCRTIRFLKRANLI Sbjct: 301 DYKELTRTKLKQFQEWIIEKYLDFVESVWPYYCRTIRFLKRANLI 345 >gb|EPS63513.1| hypothetical protein M569_11269, partial [Genlisea aurea] Length = 259 Score = 83.2 bits (204), Expect = 3e-14 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 MDYKE T+ KL D++ WL EKYLDFVESIWPYYCR IRFLKRANL+ Sbjct: 214 MDYKEFTLKKLNDLREWLTEKYLDFVESIWPYYCRAIRFLKRANLL 259 >ref|XP_007036303.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao] gi|508773548|gb|EOY20804.1| Embryo defective 2759 isoform 2, partial [Theobroma cacao] Length = 290 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DYKE++ K+KD Q W +EKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 245 LDYKELSRRKMKDFQEWAMEKYLDFVESIWPYYCRTIRFLKRANLI 290 >ref|XP_007036302.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao] gi|508773547|gb|EOY20803.1| Embryo defective 2759, putative isoform 1 [Theobroma cacao] Length = 343 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DYKE++ K+KD Q W +EKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 298 LDYKELSRRKMKDFQEWAMEKYLDFVESIWPYYCRTIRFLKRANLI 343 >ref|XP_002864832.1| EMB2759 [Arabidopsis lyrata subsp. lyrata] gi|297310667|gb|EFH41091.1| EMB2759 [Arabidopsis lyrata subsp. lyrata] Length = 345 Score = 82.8 bits (203), Expect = 4e-14 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYKE+T KLK Q W++E+YLDFVES+WPYYCRTIRFLKRANLI Sbjct: 301 DYKELTRTKLKQFQEWIIERYLDFVESVWPYYCRTIRFLKRANLI 345 >gb|EXB93587.1| hypothetical protein L484_014579 [Morus notabilis] Length = 327 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 ++YKE + KLK++Q WLVE+YLDFVESIWPYYCRTIRFLKRANLI Sbjct: 282 LNYKEFSKTKLKELQVWLVERYLDFVESIWPYYCRTIRFLKRANLI 327 >ref|XP_006394322.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum] gi|557090961|gb|ESQ31608.1| hypothetical protein EUTSA_v10004512mg [Eutrema salsugineum] Length = 344 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DY+E++ KLK Q W++EKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 300 DYRELSRTKLKQFQEWIIEKYLDFVESIWPYYCRTIRFLKRANLI 344 >ref|NP_001242677.1| uncharacterized protein LOC100798149 [Glycine max] gi|255644639|gb|ACU22822.1| unknown [Glycine max] Length = 332 Score = 81.3 bits (199), Expect = 1e-13 Identities = 35/45 (77%), Positives = 41/45 (91%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYK++T KLK++Q W+VE YLD+VESIWPYYCRTIRFLKRANLI Sbjct: 288 DYKQLTRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLKRANLI 332 >ref|XP_006344428.1| PREDICTED: uncharacterized protein LOC102597060 [Solanum tuberosum] Length = 338 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DYKE K KDI+ +LVEKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 293 LDYKEAAKRKAKDIKVYLVEKYLDFVESIWPYYCRTIRFLKRANLI 338 >ref|XP_004236230.1| PREDICTED: uncharacterized protein LOC101257648 [Solanum lycopersicum] Length = 337 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 +DYKE K KDI+ +LVEKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 292 LDYKEAAKRKAKDIEVFLVEKYLDFVESIWPYYCRTIRFLKRANLI 337 >dbj|BAB82451.1| PBng110 [Vigna radiata] Length = 198 Score = 80.1 bits (196), Expect = 3e-13 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DY+++T KLK++Q W++E+YLD+VESIWPYYCRTIRFLKRANLI Sbjct: 154 DYRQLTRKKLKELQDWVLERYLDYVESIWPYYCRTIRFLKRANLI 198 >ref|XP_007155447.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris] gi|561028801|gb|ESW27441.1| hypothetical protein PHAVU_003G202200g [Phaseolus vulgaris] Length = 334 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYK++ KLK++ W+VEKYLDFVESIWPYYCRTIRFLKRANLI Sbjct: 290 DYKQLGRKKLKELSEWIVEKYLDFVESIWPYYCRTIRFLKRANLI 334 >gb|EYU22149.1| hypothetical protein MIMGU_mgv1a009494mg [Mimulus guttatus] gi|604302593|gb|EYU22150.1| hypothetical protein MIMGU_mgv1a009494mg [Mimulus guttatus] gi|604302594|gb|EYU22151.1| hypothetical protein MIMGU_mgv1a009494mg [Mimulus guttatus] Length = 340 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -2 Query: 372 MDYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 MDYKE K+K +Q WLVEKYLD+VESIWPYYCR IRFLKRANL+ Sbjct: 295 MDYKEAARTKMKILQEWLVEKYLDYVESIWPYYCRIIRFLKRANLL 340 >ref|XP_006581918.1| PREDICTED: uncharacterized protein LOC100802447 isoform X2 [Glycine max] gi|571461174|ref|XP_006581919.1| PREDICTED: uncharacterized protein LOC100802447 isoform X3 [Glycine max] Length = 343 Score = 79.0 bits (193), Expect = 6e-13 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -2 Query: 369 DYKEVTVAKLKDIQGWLVEKYLDFVESIWPYYCRTIRFLKRANLI 235 DYK++ KLK++Q W+VE YLD+VESIWPYYCRTIRFLKRANLI Sbjct: 299 DYKQLIRKKLKELQEWIVEMYLDYVESIWPYYCRTIRFLKRANLI 343