BLASTX nr result
ID: Mentha22_contig00035835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035835 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partia... 77 3e-12 ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arieti... 63 4e-08 gb|EXB46063.1| hypothetical protein L484_015924 [Morus notabilis] 56 5e-06 gb|AFK47805.1| unknown [Medicago truncatula] 56 5e-06 gb|ACJ84998.1| unknown [Medicago truncatula] 56 5e-06 >gb|EYU46369.1| hypothetical protein MIMGU_mgv1a0120571mg, partial [Mimulus guttatus] Length = 85 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/61 (63%), Positives = 47/61 (77%), Gaps = 3/61 (4%) Frame = -3 Query: 361 DYGYR---REPLLSPYSGQASGSTRGDSDIWSSRMREKYGLNNIGGDAKQNMLNPKASAD 191 D+G+R REPL++PYS Q S S RGDSDIWSSRMR+KYGLN+ GDAK ++LN S D Sbjct: 26 DFGFRGSAREPLVAPYSSQTSPSIRGDSDIWSSRMRDKYGLNS--GDAKHSLLNQNQSND 83 Query: 190 V 188 V Sbjct: 84 V 84 >ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arietinum] Length = 251 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/43 (69%), Positives = 35/43 (81%), Gaps = 5/43 (11%) Frame = -3 Query: 355 GYRREPLLSPYSGQASGSTRGD-----SDIWSSRMREKYGLNN 242 G REPLL+P+SGQ SGS++GD SD+WSSRMREKYGLNN Sbjct: 201 GRSREPLLNPHSGQTSGSSKGDIRGNHSDVWSSRMREKYGLNN 243 >gb|EXB46063.1| hypothetical protein L484_015924 [Morus notabilis] Length = 267 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 5/54 (9%) Frame = -3 Query: 343 EPLLSPYSGQASGSTRGD-----SDIWSSRMREKYGLNNIGGDAKQNMLNPKAS 197 EPLL+P S Q SGSTRGD SDIWSSR+R+KYGLN N LN AS Sbjct: 210 EPLLNPQSSQGSGSTRGDGRGNHSDIWSSRIRDKYGLN---AGNNYNSLNQNAS 260 >gb|AFK47805.1| unknown [Medicago truncatula] Length = 249 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = -3 Query: 355 GYRREPLLSPYSGQASGSTRGD-----SDIWSSRMREKYGLNN 242 G REPLL+ SGQ SG ++GD SD+WSSRMREKYGLNN Sbjct: 199 GRSREPLLNHQSGQTSGISKGDIRGNLSDVWSSRMREKYGLNN 241 >gb|ACJ84998.1| unknown [Medicago truncatula] Length = 249 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 5/43 (11%) Frame = -3 Query: 355 GYRREPLLSPYSGQASGSTRGD-----SDIWSSRMREKYGLNN 242 G REPLL+ SGQ SG ++GD SD+WSSRMREKYGLNN Sbjct: 199 GRSREPLLNHQSGQTSGISKGDIRGNLSDVWSSRMREKYGLNN 241