BLASTX nr result
ID: Mentha22_contig00035431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035431 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32520.1| hypothetical protein MIMGU_mgv1a005704mg [Mimulus... 57 3e-06 >gb|EYU32520.1| hypothetical protein MIMGU_mgv1a005704mg [Mimulus guttatus] Length = 474 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 106 MEGMWTGLNGNAMEFFNSTAVMEALFDVLVCAVPI 2 MEG W GLN N EFFN+ AVMEA D+LVCAVPI Sbjct: 1 MEGGWVGLNNNGFEFFNTPAVMEAFVDILVCAVPI 35