BLASTX nr result
ID: Mentha22_contig00035354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035354 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI25497.3| unnamed protein product [Vitis vinifera] 100 2e-19 ref|XP_002271416.1| PREDICTED: arginyl-tRNA--protein transferase... 100 2e-19 ref|XP_002526898.1| Arginyl-tRNA--protein transferase, putative ... 100 2e-19 gb|EYU22340.1| hypothetical protein MIMGU_mgv1a003118mg [Mimulus... 99 5e-19 ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase... 97 2e-18 gb|EPS68999.1| hypothetical protein M569_05762, partial [Genlise... 97 2e-18 ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase... 97 2e-18 ref|XP_006378668.1| hypothetical protein POPTR_0010s19740g [Popu... 95 9e-18 ref|XP_004307634.1| PREDICTED: arginyl-tRNA--protein transferase... 95 1e-17 ref|XP_004307633.1| PREDICTED: arginyl-tRNA--protein transferase... 95 1e-17 ref|XP_004500677.1| PREDICTED: arginyl-tRNA--protein transferase... 94 3e-17 ref|XP_002884838.1| hypothetical protein ARALYDRAFT_478464 [Arab... 94 3e-17 ref|XP_003552429.1| PREDICTED: arginyl-tRNA--protein transferase... 92 1e-16 ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putativ... 91 2e-16 ref|XP_004961918.1| PREDICTED: arginyl-tRNA--protein transferase... 90 3e-16 ref|XP_002441188.1| hypothetical protein SORBIDRAFT_09g021940 [S... 90 3e-16 ref|NP_001169162.1| uncharacterized protein LOC100383012 [Zea ma... 90 3e-16 ref|XP_006654483.1| PREDICTED: arginyl-tRNA--protein transferase... 90 4e-16 ref|XP_006300018.1| hypothetical protein CARUB_v10016242mg [Caps... 89 5e-16 gb|EEC79311.1| hypothetical protein OsI_20147 [Oryza sativa Indi... 89 5e-16 >emb|CBI25497.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 100 bits (249), Expect = 2e-19 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V DVGRR+STCGYC+SGARTSISHGLWAHS+TVDDYQ LLDRGWRRSG F Sbjct: 26 VVDVGRRRSTCGYCRSGARTSISHGLWAHSITVDDYQDLLDRGWRRSGSF 75 >ref|XP_002271416.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Vitis vinifera] Length = 640 Score = 100 bits (249), Expect = 2e-19 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V DVGRR+STCGYC+SGARTSISHGLWAHS+TVDDYQ LLDRGWRRSG F Sbjct: 26 VVDVGRRRSTCGYCRSGARTSISHGLWAHSITVDDYQDLLDRGWRRSGSF 75 >ref|XP_002526898.1| Arginyl-tRNA--protein transferase, putative [Ricinus communis] gi|223533797|gb|EEF35529.1| Arginyl-tRNA--protein transferase, putative [Ricinus communis] Length = 629 Score = 100 bits (249), Expect = 2e-19 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRRKS+CGYC+SGARTSISHGLWAHS++VDDYQ LLDRGWRRSGCF Sbjct: 24 VVDCGRRKSSCGYCRSGARTSISHGLWAHSISVDDYQDLLDRGWRRSGCF 73 >gb|EYU22340.1| hypothetical protein MIMGU_mgv1a003118mg [Mimulus guttatus] Length = 607 Score = 99.4 bits (246), Expect = 5e-19 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GR+KSTCGYCKSGARTSISHGLW SLTVDDYQAL+DRGWRRSGC+ Sbjct: 30 VTDCGRQKSTCGYCKSGARTSISHGLWPQSLTVDDYQALIDRGWRRSGCY 79 >ref|XP_006338855.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum tuberosum] Length = 640 Score = 97.4 bits (241), Expect = 2e-18 Identities = 43/50 (86%), Positives = 44/50 (88%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V DVGRR+S CGYCKSG TSISHGLW SLTVDDYQALLDRGWRRSGCF Sbjct: 29 VVDVGRRRSPCGYCKSGGPTSISHGLWTRSLTVDDYQALLDRGWRRSGCF 78 >gb|EPS68999.1| hypothetical protein M569_05762, partial [Genlisea aurea] Length = 494 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D G R+S+CGYCKSG+RTSISHGLWAHSLTVD YQ LLDRGWRRSGCF Sbjct: 20 VVDFGHRRSSCGYCKSGSRTSISHGLWAHSLTVDAYQGLLDRGWRRSGCF 69 >ref|XP_004240947.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Solanum lycopersicum] Length = 640 Score = 97.1 bits (240), Expect = 2e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V +VGRR+++CGYCKSG TSISHGLWA SLTVDDYQALLDRGWRRSGCF Sbjct: 27 VVEVGRRRNSCGYCKSGGPTSISHGLWARSLTVDDYQALLDRGWRRSGCF 76 >ref|XP_006378668.1| hypothetical protein POPTR_0010s19740g [Populus trichocarpa] gi|550330183|gb|ERP56465.1| hypothetical protein POPTR_0010s19740g [Populus trichocarpa] Length = 542 Score = 95.1 bits (235), Expect = 9e-18 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V+D GRRKS+CGYCKS +RTS+SHGLWAHS+TVDDYQ LLDRGWRRSG F Sbjct: 28 VSDCGRRKSSCGYCKSTSRTSVSHGLWAHSITVDDYQDLLDRGWRRSGSF 77 >ref|XP_004307634.1| PREDICTED: arginyl-tRNA--protein transferase 1-like isoform 2 [Fragaria vesca subsp. vesca] Length = 619 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D G+ KSTCGYC+S ARTSISHGLWAHS+T++DYQ LLDRGWRRSGCF Sbjct: 28 VVDYGKNKSTCGYCRSKARTSISHGLWAHSVTINDYQDLLDRGWRRSGCF 77 >ref|XP_004307633.1| PREDICTED: arginyl-tRNA--protein transferase 1-like isoform 1 [Fragaria vesca subsp. vesca] Length = 671 Score = 94.7 bits (234), Expect = 1e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D G+ KSTCGYC+S ARTSISHGLWAHS+T++DYQ LLDRGWRRSGCF Sbjct: 28 VVDYGKNKSTCGYCRSKARTSISHGLWAHSVTINDYQDLLDRGWRRSGCF 77 >ref|XP_004500677.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Cicer arietinum] Length = 634 Score = 93.6 bits (231), Expect = 3e-17 Identities = 40/50 (80%), Positives = 44/50 (88%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D G+R+S+CGYCKS SISHG+WAHSLTVDDYQALLDRGWRRSGCF Sbjct: 22 VVDWGKRRSSCGYCKSPRNNSISHGMWAHSLTVDDYQALLDRGWRRSGCF 71 >ref|XP_002884838.1| hypothetical protein ARALYDRAFT_478464 [Arabidopsis lyrata subsp. lyrata] gi|297330678|gb|EFH61097.1| hypothetical protein ARALYDRAFT_478464 [Arabidopsis lyrata subsp. lyrata] Length = 602 Score = 93.6 bits (231), Expect = 3e-17 Identities = 41/50 (82%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 VAD GR KSTCGYCKS R+SISHGLW LTV+DYQALLDRGWRRSGCF Sbjct: 25 VADCGRNKSTCGYCKSSTRSSISHGLWTERLTVNDYQALLDRGWRRSGCF 74 >ref|XP_003552429.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Glycine max] Length = 612 Score = 91.7 bits (226), Expect = 1e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR+++CGYC+S SISHG+WAHSLTVDDYQ LLDRGWRRSGCF Sbjct: 14 VVDCGRRRTSCGYCRSSRHNSISHGMWAHSLTVDDYQDLLDRGWRRSGCF 63 >ref|XP_007009019.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] gi|508725932|gb|EOY17829.1| Arginine-tRNA protein transferase 1, putative isoform 1 [Theobroma cacao] Length = 628 Score = 90.9 bits (224), Expect = 2e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR+S+CGYCKS RTS+SHGLWAHS+ V+DYQ LLD GWRRSGCF Sbjct: 16 VVDCGRRRSSCGYCKSSGRTSVSHGLWAHSIAVNDYQDLLDCGWRRSGCF 65 >ref|XP_004961918.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Setaria italica] Length = 636 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR++TCGYC+S TSISHG+WA+SL DDYQALLDRGWRRSGCF Sbjct: 19 VIDYGRRRTTCGYCRSSGPTSISHGMWANSLKADDYQALLDRGWRRSGCF 68 >ref|XP_002441188.1| hypothetical protein SORBIDRAFT_09g021940 [Sorghum bicolor] gi|241946473|gb|EES19618.1| hypothetical protein SORBIDRAFT_09g021940 [Sorghum bicolor] Length = 638 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR++TCGYC+S TSISHG+WA+SL DDYQALLDRGWRRSGCF Sbjct: 19 VIDYGRRRTTCGYCRSSGPTSISHGMWANSLKADDYQALLDRGWRRSGCF 68 >ref|NP_001169162.1| uncharacterized protein LOC100383012 [Zea mays] gi|223975253|gb|ACN31814.1| unknown [Zea mays] gi|413949114|gb|AFW81763.1| putative arginine-tRNA protein transferase family protein [Zea mays] Length = 641 Score = 90.1 bits (222), Expect = 3e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR++TCGYC+S TSISHG+WA+SL DDYQALLDRGWRRSGCF Sbjct: 19 VIDYGRRRTTCGYCRSSGPTSISHGMWANSLKADDYQALLDRGWRRSGCF 68 >ref|XP_006654483.1| PREDICTED: arginyl-tRNA--protein transferase 1-like [Oryza brachyantha] Length = 642 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 145 DVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 D GRR++TCGYC+S TSISHGLWA+SL DDYQALLDRGWRRSGCF Sbjct: 29 DYGRRRTTCGYCRSTGHTSISHGLWANSLKADDYQALLDRGWRRSGCF 76 >ref|XP_006300018.1| hypothetical protein CARUB_v10016242mg [Capsella rubella] gi|482568727|gb|EOA32916.1| hypothetical protein CARUB_v10016242mg [Capsella rubella] Length = 607 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 VAD GR +STCGYCKS R+SISHGL SLTV+DYQALLDRGWRRSGCF Sbjct: 25 VADCGRNRSTCGYCKSSTRSSISHGLLTESLTVNDYQALLDRGWRRSGCF 74 >gb|EEC79311.1| hypothetical protein OsI_20147 [Oryza sativa Indica Group] Length = 644 Score = 89.4 bits (220), Expect = 5e-16 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 VADVGRRKSTCGYCKSGARTSISHGLWAHSLTVDDYQALLDRGWRRSGCF 2 V D GRR++ CGYC+S +TSISHGLWA+SL DDYQALLDRGWRRSGCF Sbjct: 26 VIDYGRRRTACGYCRSTGQTSISHGLWANSLRADDYQALLDRGWRRSGCF 75