BLASTX nr result
ID: Mentha22_contig00035327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035327 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006379232.1| Cf-4/9 disease resistance-like family protei... 59 7e-07 ref|XP_006389187.1| hypothetical protein POPTR_0039s00380g [Popu... 57 3e-06 >ref|XP_006379232.1| Cf-4/9 disease resistance-like family protein [Populus trichocarpa] gi|566187486|ref|XP_002313815.2| hypothetical protein POPTR_0009s11510g [Populus trichocarpa] gi|550331523|gb|ERP57029.1| Cf-4/9 disease resistance-like family protein [Populus trichocarpa] gi|550331524|gb|EEE87770.2| hypothetical protein POPTR_0009s11510g [Populus trichocarpa] Length = 1036 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/52 (46%), Positives = 32/52 (61%) Frame = -1 Query: 414 PSPLMNEEEDGDSTFGEVLCWEAVVSGYGSGCIIGVTTGYFILRCKRPTWLV 259 P P +EE D S FG+ W+AVV GYG G ++G T GY + R ++P W V Sbjct: 959 PPPSNSEEGDDSSLFGDGFGWKAVVMGYGCGFVLGATVGYIVFRTRKPAWFV 1010 >ref|XP_006389187.1| hypothetical protein POPTR_0039s00380g [Populus trichocarpa] gi|550311883|gb|ERP48101.1| hypothetical protein POPTR_0039s00380g [Populus trichocarpa] Length = 875 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/60 (40%), Positives = 35/60 (58%) Frame = -1 Query: 408 PLMNEEEDGDSTFGEVLCWEAVVSGYGSGCIIGVTTGYFILRCKRPTWLVEWLYGIFRIK 229 P +E D + FGE W+AV GYG G + GV TGY + R K+P+W + + I+ +K Sbjct: 800 PSSFDEGDDSTLFGEGFGWKAVTVGYGCGFVFGVATGYVVFRTKKPSWFLRMVEDIWNLK 859