BLASTX nr result
ID: Mentha22_contig00035270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035270 (340 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32266.1| hypothetical protein MIMGU_mgv1a000024mg [Mimulus... 87 2e-15 >gb|EYU32266.1| hypothetical protein MIMGU_mgv1a000024mg [Mimulus guttatus] Length = 2473 Score = 87.4 bits (215), Expect = 2e-15 Identities = 57/109 (52%), Positives = 65/109 (59%) Frame = -3 Query: 338 SKFLEHLLSSLPEVPDEISPSQSFPVLELNGNNLQQQARLASSTLVEFLRLTCSAISYNS 159 SK LEH L+ L EV +E S S PVLE N N LQ SS LVEFL+L C+ IS+ Sbjct: 1794 SKLLEHQLTRLSEVLNESCSSPSLPVLESNNNELQ-----LSSPLVEFLKLNCADISFYC 1848 Query: 158 SKQFAIYLLQEVNILNRNYLSCFEDGLSQPRGGNNNQMSEYAKLLDNGN 12 SKQFA YLL+EVN+ NR L D L Q G +QM KLLDN N Sbjct: 1849 SKQFATYLLREVNLSNRTDLFYLVDSLFQ--RGAEDQMGGNRKLLDNLN 1895