BLASTX nr result
ID: Mentha22_contig00035170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035170 (360 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006285815.1| hypothetical protein CARUB_v10007291mg [Caps... 48 4e-09 gb|EYU24931.1| hypothetical protein MIMGU_mgv1a007592mg [Mimulus... 55 8e-06 >ref|XP_006285815.1| hypothetical protein CARUB_v10007291mg [Capsella rubella] gi|482554520|gb|EOA18713.1| hypothetical protein CARUB_v10007291mg [Capsella rubella] Length = 437 Score = 47.8 bits (112), Expect(2) = 4e-09 Identities = 21/43 (48%), Positives = 31/43 (72%), Gaps = 4/43 (9%) Frame = +2 Query: 239 TQEEEHGAAK---NDGWETVGQK-PSKKHHKVPTNQWNNYKRP 355 T++++ +K NDGWETVG+K P+++ HKV QW +YKRP Sbjct: 102 TEQQDFSESKQEDNDGWETVGKKKPARQSHKVQKEQWGDYKRP 144 Score = 38.5 bits (88), Expect(2) = 4e-09 Identities = 15/30 (50%), Positives = 24/30 (80%) Frame = +1 Query: 76 EQSRSTWSQVVSGDQEEPDASGYSGSRPSH 165 E+SRS+W+ VVSG++E+ + +G S+PSH Sbjct: 35 ERSRSSWADVVSGEEEDQNRAGGGSSQPSH 64 >gb|EYU24931.1| hypothetical protein MIMGU_mgv1a007592mg [Mimulus guttatus] Length = 402 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/42 (61%), Positives = 29/42 (69%), Gaps = 3/42 (7%) Frame = +2 Query: 239 TQEEEHGAAKNDGWETVGQK---PSKKHHKVPTNQWNNYKRP 355 TQ+EE DGWETV QK PSK+HHKV + WNNYKRP Sbjct: 69 TQKEEGDENSTDGWETVQQKKKKPSKQHHKVIKDNWNNYKRP 110