BLASTX nr result
ID: Mentha22_contig00035149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035149 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520529.1| pentatricopeptide repeat-containing protein,... 62 6e-08 gb|EYU45950.1| hypothetical protein MIMGU_mgv1a024533mg, partial... 62 8e-08 ref|XP_003632146.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 emb|CBI16090.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_004240613.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 ref|XP_002314162.2| hypothetical protein POPTR_0009s04000g, part... 57 3e-06 ref|XP_004289402.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_002520529.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540371|gb|EEF41942.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 606 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +1 Query: 40 PNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAISWI 171 P+DPA Y+LL+N+LA EG WDDA++VRK +C+RG+ K SWI Sbjct: 563 PDDPATYILLSNMLATEGYWDDAADVRKLMCDRGVRKNPGYSWI 606 >gb|EYU45950.1| hypothetical protein MIMGU_mgv1a024533mg, partial [Mimulus guttatus] Length = 596 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +1 Query: 4 RKLVQEQPEE*CPNDPAIYVLLANVLANEGSWDDASEVRKQICNRG 141 RKLV E CP DPAIYVLLANVLA EGSW+DA+ VRK +C++G Sbjct: 556 RKLV-----ELCPKDPAIYVLLANVLATEGSWNDAARVRKIMCDKG 596 >ref|XP_003632146.1| PREDICTED: pentatricopeptide repeat-containing protein At4g13650-like [Vitis vinifera] Length = 628 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 37 CPNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAISWI 171 CPNDP IYVLL+NV A G WD+ + +RK +C+RG+ K+ SWI Sbjct: 584 CPNDPVIYVLLSNVQATVGYWDNVASIRKVMCDRGVRKEPGYSWI 628 >emb|CBI16090.3| unnamed protein product [Vitis vinifera] Length = 458 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/45 (55%), Positives = 33/45 (73%) Frame = +1 Query: 37 CPNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAISWI 171 CPNDP IYVLL+NV A G WD+ + +RK +C+RG+ K+ SWI Sbjct: 414 CPNDPVIYVLLSNVQATVGYWDNVASIRKVMCDRGVRKEPGYSWI 458 >ref|XP_004240613.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610-like [Solanum lycopersicum] Length = 536 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 40 PNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAISWI 171 PNDPA YVLLANVLA EG+W DA RK + +RG+ KK SW+ Sbjct: 493 PNDPATYVLLANVLALEGNWKDAEGQRKLMLDRGLSKKPGYSWL 536 >ref|XP_002314162.2| hypothetical protein POPTR_0009s04000g, partial [Populus trichocarpa] gi|550330984|gb|EEE88117.2| hypothetical protein POPTR_0009s04000g, partial [Populus trichocarpa] Length = 606 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = +1 Query: 40 PNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAI 162 PNDPA YVLL++VL +G+WDDA+++RK +C+RG+ KK + Sbjct: 559 PNDPATYVLLSSVLTVDGNWDDAADLRKLMCDRGLRKKPGV 599 >ref|XP_004289402.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Fragaria vesca subsp. vesca] Length = 558 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +1 Query: 37 CPNDPAIYVLLANVLANEGSWDDASEVRKQICNRGMVKKVAISWI 171 CPND Y+LL+NVL GSWDDA+ VRK + +RG+ K SWI Sbjct: 514 CPNDHGTYILLSNVLLTRGSWDDAAGVRKFMYDRGIRKTPGYSWI 558