BLASTX nr result
ID: Mentha22_contig00035148
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035148 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU30667.1| hypothetical protein MIMGU_mgv1a014222mg [Mimulus... 80 4e-13 ref|XP_004158435.1| PREDICTED: uncharacterized protein LOC101229... 73 4e-11 ref|XP_004135689.1| PREDICTED: uncharacterized protein LOC101204... 73 4e-11 ref|XP_007012927.1| Uncharacterized protein isoform 2 [Theobroma... 72 6e-11 ref|XP_007012926.1| Uncharacterized protein isoform 1 [Theobroma... 72 6e-11 ref|XP_002514174.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 gb|EXB24683.1| hypothetical protein L484_005477 [Morus notabilis] 70 4e-10 ref|XP_006284557.1| hypothetical protein CARUB_v10005778mg [Caps... 69 7e-10 ref|XP_006345648.1| PREDICTED: uncharacterized protein LOC102581... 69 9e-10 ref|XP_007160254.1| hypothetical protein PHAVU_002G305700g [Phas... 69 9e-10 ref|XP_007202609.1| hypothetical protein PRUPE_ppa011771mg [Prun... 68 2e-09 ref|XP_002283005.1| PREDICTED: uncharacterized protein LOC100262... 67 3e-09 emb|CBI27957.3| unnamed protein product [Vitis vinifera] 67 3e-09 ref|XP_002867574.1| hypothetical protein ARALYDRAFT_913938 [Arab... 67 3e-09 ref|NP_567740.1| uncharacterized protein [Arabidopsis thaliana] ... 67 3e-09 ref|XP_003525303.1| PREDICTED: uncharacterized protein LOC100791... 66 4e-09 ref|NP_001242783.1| uncharacterized protein LOC100804066 [Glycin... 66 4e-09 ref|XP_006451372.1| hypothetical protein CICLE_v10009577mg [Citr... 66 6e-09 ref|XP_004503522.1| PREDICTED: uncharacterized protein LOC101495... 65 7e-09 ref|XP_004287509.1| PREDICTED: uncharacterized protein LOC101306... 65 7e-09 >gb|EYU30667.1| hypothetical protein MIMGU_mgv1a014222mg [Mimulus guttatus] Length = 197 Score = 79.7 bits (195), Expect = 4e-13 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKAY 315 DI+W+PLTPLGGAG CLYVD LL++SSEEVRKLRGYMY++KAY Sbjct: 155 DIVWLPLTPLGGAGICLYVDYLLNQSSEEVRKLRGYMYSYKAY 197 >ref|XP_004158435.1| PREDICTED: uncharacterized protein LOC101229744 [Cucumis sativus] Length = 143 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+PL PL GAG CLYVD LL+ESSEE+RKLRGYMY++KA Sbjct: 101 DVIWLPLGPLSGAGICLYVDHLLAESSEEIRKLRGYMYSYKA 142 >ref|XP_004135689.1| PREDICTED: uncharacterized protein LOC101204679 [Cucumis sativus] Length = 199 Score = 73.2 bits (178), Expect = 4e-11 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+PL PL GAG CLYVD LL+ESSEE+RKLRGYMY++KA Sbjct: 157 DVIWLPLGPLSGAGICLYVDHLLAESSEEIRKLRGYMYSYKA 198 >ref|XP_007012927.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508783290|gb|EOY30546.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 192 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+PL P G+G CLYVD LLSESSEEVRKLR YMYAFKA Sbjct: 150 DVIWLPLGPFSGSGVCLYVDHLLSESSEEVRKLRSYMYAFKA 191 >ref|XP_007012926.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783289|gb|EOY30545.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 199 Score = 72.4 bits (176), Expect = 6e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+PL P G+G CLYVD LLSESSEEVRKLR YMYAFKA Sbjct: 157 DVIWLPLGPFSGSGVCLYVDHLLSESSEEVRKLRSYMYAFKA 198 >ref|XP_002514174.1| conserved hypothetical protein [Ricinus communis] gi|223546630|gb|EEF48128.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D+LW+P PL GAG LYVD LL ESSEEVRKLRGYMYAFKA Sbjct: 155 DVLWLPFGPLSGAGLSLYVDHLLIESSEEVRKLRGYMYAFKA 196 >gb|EXB24683.1| hypothetical protein L484_005477 [Morus notabilis] Length = 192 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PL GAG LYVD LL ESSEE+RKLRGYMYAFKA Sbjct: 150 DVIWLPFGPLSGAGISLYVDHLLDESSEEIRKLRGYMYAFKA 191 >ref|XP_006284557.1| hypothetical protein CARUB_v10005778mg [Capsella rubella] gi|482553262|gb|EOA17455.1| hypothetical protein CARUB_v10005778mg [Capsella rubella] Length = 198 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D +W+P PL GAGTCLYVD LL ESSEEV+KLR YMYA+KA Sbjct: 156 DAIWLPFGPLCGAGTCLYVDHLLEESSEEVKKLRNYMYAYKA 197 >ref|XP_006345648.1| PREDICTED: uncharacterized protein LOC102581175 [Solanum tuberosum] Length = 199 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+PL P+ GAG C+YV+ LL+ SSEEVRKLRGYMYA+KA Sbjct: 157 DVVWLPLGPISGAGVCIYVEYLLNVSSEEVRKLRGYMYAYKA 198 >ref|XP_007160254.1| hypothetical protein PHAVU_002G305700g [Phaseolus vulgaris] gi|561033669|gb|ESW32248.1| hypothetical protein PHAVU_002G305700g [Phaseolus vulgaris] Length = 193 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PLG + CLYVD LL+ESSEEVRKLRGYMY +KA Sbjct: 151 DVIWLPFGPLGASAVCLYVDRLLTESSEEVRKLRGYMYTYKA 192 >ref|XP_007202609.1| hypothetical protein PRUPE_ppa011771mg [Prunus persica] gi|462398140|gb|EMJ03808.1| hypothetical protein PRUPE_ppa011771mg [Prunus persica] Length = 197 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PL GAG LYVD LL ESSEE+RKLRGYMYA+KA Sbjct: 155 DVIWLPFGPLSGAGLTLYVDHLLIESSEEIRKLRGYMYAYKA 196 >ref|XP_002283005.1| PREDICTED: uncharacterized protein LOC100262721 [Vitis vinifera] Length = 198 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PLGGA LYVD LL+ESSEEVRKLR YMYA+KA Sbjct: 156 DVIWLPFGPLGGAALSLYVDHLLNESSEEVRKLRSYMYAYKA 197 >emb|CBI27957.3| unnamed protein product [Vitis vinifera] Length = 196 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PLGGA LYVD LL+ESSEEVRKLR YMYA+KA Sbjct: 154 DVIWLPFGPLGGAALSLYVDHLLNESSEEVRKLRSYMYAYKA 195 >ref|XP_002867574.1| hypothetical protein ARALYDRAFT_913938 [Arabidopsis lyrata subsp. lyrata] gi|297313410|gb|EFH43833.1| hypothetical protein ARALYDRAFT_913938 [Arabidopsis lyrata subsp. lyrata] Length = 198 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D +W+P PL GAG CLYVD LL ESSEEV+KLR YMYA+KA Sbjct: 156 DAIWLPFGPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKA 197 >ref|NP_567740.1| uncharacterized protein [Arabidopsis thaliana] gi|19699021|gb|AAL91246.1| unknown protein [Arabidopsis thaliana] gi|21553430|gb|AAM62523.1| unknown [Arabidopsis thaliana] gi|22136340|gb|AAM91248.1| unknown protein [Arabidopsis thaliana] gi|332659774|gb|AEE85174.1| uncharacterized protein AT4G26240 [Arabidopsis thaliana] Length = 198 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D +W+P PL GAG CLYVD LL ESSEEV+KLR YMYA+KA Sbjct: 156 DAIWLPFGPLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKA 197 >ref|XP_003525303.1| PREDICTED: uncharacterized protein LOC100791130 isoform X1 [Glycine max] Length = 193 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PLG + CLYVD LL+ESSEEVRKLRGYMY KA Sbjct: 151 DVIWLPFGPLGASAICLYVDHLLTESSEEVRKLRGYMYTSKA 192 >ref|NP_001242783.1| uncharacterized protein LOC100804066 [Glycine max] gi|255640758|gb|ACU20663.1| unknown [Glycine max] Length = 193 Score = 66.2 bits (160), Expect = 4e-09 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PLG + CLYVD LL+ESSEEVRKLRGYMY KA Sbjct: 151 DVIWLPFGPLGASAICLYVDHLLTESSEEVRKLRGYMYTSKA 192 >ref|XP_006451372.1| hypothetical protein CICLE_v10009577mg [Citrus clementina] gi|568842918|ref|XP_006475375.1| PREDICTED: uncharacterized protein LOC102611767 [Citrus sinensis] gi|557554598|gb|ESR64612.1| hypothetical protein CICLE_v10009577mg [Citrus clementina] Length = 194 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PL GAG CLYVD L+ES E+VRKLR YMYA+KA Sbjct: 152 DVIWLPFGPLSGAGICLYVDHALNESREDVRKLRSYMYAYKA 193 >ref|XP_004503522.1| PREDICTED: uncharacterized protein LOC101495244 [Cicer arietinum] Length = 193 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P PL + CLYVD LL+ESSEEVRKL GYMYA+KA Sbjct: 151 DVIWLPFGPLSASSICLYVDHLLTESSEEVRKLHGYMYAYKA 192 >ref|XP_004287509.1| PREDICTED: uncharacterized protein LOC101306458 [Fragaria vesca subsp. vesca] Length = 192 Score = 65.5 bits (158), Expect = 7e-09 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 443 DILWVPLTPLGGAGTCLYVDGLLSESSEEVRKLRGYMYAFKA 318 D++W+P P+ G G LYVD LL ESSEE+RKLRGYMYA+KA Sbjct: 150 DVIWLPFGPISGTGLSLYVDHLLLESSEEIRKLRGYMYAYKA 191