BLASTX nr result
ID: Mentha22_contig00035085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035085 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18222.1| hypothetical protein MIMGU_mgv1a001607mg [Mimulus... 64 3e-08 gb|EPS68908.1| microtubule-associated protein, partial [Genlisea... 56 6e-06 ref|XP_004242821.1| PREDICTED: uncharacterized protein LOC101260... 56 6e-06 gb|ADB08056.1| microtubule-associated protein [Nicotiana bentham... 56 6e-06 >gb|EYU18222.1| hypothetical protein MIMGU_mgv1a001607mg [Mimulus guttatus] Length = 786 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/41 (78%), Positives = 36/41 (87%), Gaps = 3/41 (7%) Frame = +1 Query: 298 TAMPETASCS---RRFGGLRGVKWRVDLGILPSSPAATIDD 411 TA+PETAS S RRFG LRGV+WRVDLGILPSSP+A+IDD Sbjct: 5 TALPETASFSGGSRRFGDLRGVQWRVDLGILPSSPSASIDD 45 >gb|EPS68908.1| microtubule-associated protein, partial [Genlisea aurea] Length = 454 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = +1 Query: 304 MPETASCS---RRFGGLRGVKWRVDLGILPSSPAATIDD 411 M ETA+CS RRFG LR ++WR+DLGILPSSP+A+IDD Sbjct: 2 MLETATCSGCWRRFGYLRSLQWRIDLGILPSSPSASIDD 40 >ref|XP_004242821.1| PREDICTED: uncharacterized protein LOC101260951 [Solanum lycopersicum] Length = 822 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 325 SRRFGGLRGVKWRVDLGILPSSPAATIDD 411 SRRFG LRGV+WR+DLGILPSSP++TIDD Sbjct: 18 SRRFGDLRGVQWRIDLGILPSSPSSTIDD 46 >gb|ADB08056.1| microtubule-associated protein [Nicotiana benthamiana] Length = 813 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 325 SRRFGGLRGVKWRVDLGILPSSPAATIDD 411 SRRFG LRG++WR+DLGILPSSP++TIDD Sbjct: 15 SRRFGDLRGIRWRIDLGILPSSPSSTIDD 43