BLASTX nr result
ID: Mentha22_contig00035052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035052 (657 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus... 71 3e-10 ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-l... 68 3e-09 gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] 68 3e-09 gb|AAD27848.1|AF130973_1 peroxisomal targeting signal type 2 rec... 68 3e-09 ref|NP_174220.1| peroxin 7 [Arabidopsis thaliana] gi|317412016|s... 68 3e-09 ref|XP_002893553.1| hypothetical protein ARALYDRAFT_473130 [Arab... 68 3e-09 ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-l... 67 4e-09 ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citr... 67 4e-09 ref|NP_001234299.1| peroxisomal targeting signal type 2 receptor... 67 6e-09 dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] 67 6e-09 gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] 66 1e-08 ref|XP_007025371.1| Peroxin 7 [Theobroma cacao] gi|508780737|gb|... 65 1e-08 ref|XP_006305988.1| hypothetical protein CARUB_v10011256mg [Caps... 65 1e-08 ref|XP_006415603.1| hypothetical protein EUTSA_v10008237mg [Eutr... 65 2e-08 gb|ABB92566.1| peroxisomal import receptor PTS2 [Brassica napus] 65 2e-08 gb|ABD91573.1| pectinesterase-like protein [Brassica rapa] 65 2e-08 gb|EPS72528.1| peroxisomal targeting signal type 2 receptor [Gen... 65 2e-08 ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-l... 65 2e-08 ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phas... 64 3e-08 gb|AAL27434.1|AF430070_1 peroxisomal targeting signal 2 receptor... 64 4e-08 >gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus guttatus] Length = 314 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVRNYRVP+AVLNGHGYAVRKVKFSPHRGS+ Sbjct: 216 VWDVRNYRVPVAVLNGHGYAVRKVKFSPHRGSV 248 >ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGS 560 VWDVRNYRVP+AVLNGHGYAVRKV+FSPHR S Sbjct: 218 VWDVRNYRVPIAVLNGHGYAVRKVRFSPHRAS 249 >gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] Length = 316 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGS 560 VWDVRNYRVP+AVLNGHGYAVRKV+FSPHR S Sbjct: 218 VWDVRNYRVPIAVLNGHGYAVRKVRFSPHRAS 249 >gb|AAD27848.1|AF130973_1 peroxisomal targeting signal type 2 receptor [Arabidopsis thaliana] Length = 317 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YRVPLAVLNGHGYAVRKVKFSPHR S+ Sbjct: 219 VWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSL 251 >ref|NP_174220.1| peroxin 7 [Arabidopsis thaliana] gi|317412016|sp|Q9XF57.2|PEX7_ARATH RecName: Full=Peroxisome biogenesis protein 7; AltName: Full=Peroxin-7; Short=AtPEX7; AltName: Full=Peroxisomal targeting signal type 2 receptor; AltName: Full=Pex7p gi|9502414|gb|AAF88113.1|AC021043_6 peroxisomal targeting signal type 2 receptor, Pex7p [Arabidopsis thaliana] gi|89274147|gb|ABD65594.1| At1g29260 [Arabidopsis thaliana] gi|332192945|gb|AEE31066.1| peroxin 7 [Arabidopsis thaliana] Length = 317 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YRVPLAVLNGHGYAVRKVKFSPHR S+ Sbjct: 219 VWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSL 251 >ref|XP_002893553.1| hypothetical protein ARALYDRAFT_473130 [Arabidopsis lyrata subsp. lyrata] gi|297339395|gb|EFH69812.1| hypothetical protein ARALYDRAFT_473130 [Arabidopsis lyrata subsp. lyrata] Length = 317 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YRVPLAVLNGHGYAVRKVKFSPHR S+ Sbjct: 219 VWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSL 251 >ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGS 560 VWD+RNYRVP+AVLNGHGYAVRKV+FSPHR S Sbjct: 218 VWDIRNYRVPIAVLNGHGYAVRKVRFSPHRAS 249 >ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] gi|568826569|ref|XP_006467644.1| PREDICTED: peroxisome biogenesis protein 7-like [Citrus sinensis] gi|557552118|gb|ESR62747.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] Length = 317 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 +WDVRNYRVP+AVLNGHGYAVRKVKFSPHR ++ Sbjct: 219 IWDVRNYRVPIAVLNGHGYAVRKVKFSPHRRNL 251 >ref|NP_001234299.1| peroxisomal targeting signal type 2 receptor [Solanum lycopersicum] gi|28195239|gb|AAO27452.1| peroxisomal targeting signal type 2 receptor [Solanum lycopersicum] Length = 317 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGS 560 VWDVRNYRVP++VLNGHGYAVRKV+FSPHR S Sbjct: 218 VWDVRNYRVPISVLNGHGYAVRKVRFSPHRAS 249 >dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] Length = 316 Score = 66.6 bits (161), Expect = 6e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGS 560 VWDVRNYRVP++VLNGHGYAVRKV+FSPHR S Sbjct: 218 VWDVRNYRVPISVLNGHGYAVRKVRFSPHRAS 249 >gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] Length = 319 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVRN+RVP++VLNGHGYAVRKVKFSPHR S+ Sbjct: 221 VWDVRNFRVPVSVLNGHGYAVRKVKFSPHRRSL 253 >ref|XP_007025371.1| Peroxin 7 [Theobroma cacao] gi|508780737|gb|EOY27993.1| Peroxin 7 [Theobroma cacao] Length = 316 Score = 65.5 bits (158), Expect = 1e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 +WDVRNYRVP++VLNGHGYAVRK+KFSPHR ++ Sbjct: 219 IWDVRNYRVPVSVLNGHGYAVRKIKFSPHRRNL 251 >ref|XP_006305988.1| hypothetical protein CARUB_v10011256mg [Capsella rubella] gi|482574699|gb|EOA38886.1| hypothetical protein CARUB_v10011256mg [Capsella rubella] Length = 317 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YRVPLAVLNGHGYAV+KVKFSPHR ++ Sbjct: 219 VWDVRSYRVPLAVLNGHGYAVKKVKFSPHRRNL 251 >ref|XP_006415603.1| hypothetical protein EUTSA_v10008237mg [Eutrema salsugineum] gi|557093374|gb|ESQ33956.1| hypothetical protein EUTSA_v10008237mg [Eutrema salsugineum] Length = 317 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YR PLAVLNGHGYAVRKVKFSPHR ++ Sbjct: 219 VWDVRSYRAPLAVLNGHGYAVRKVKFSPHRRNL 251 >gb|ABB92566.1| peroxisomal import receptor PTS2 [Brassica napus] Length = 317 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YR PLAVLNGHGYAVRKVKFSPHR ++ Sbjct: 219 VWDVRSYRAPLAVLNGHGYAVRKVKFSPHRRNL 251 >gb|ABD91573.1| pectinesterase-like protein [Brassica rapa] Length = 317 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVR+YR PLAVLNGHGYAVRKVKFSPHR ++ Sbjct: 219 VWDVRSYRAPLAVLNGHGYAVRKVKFSPHRRNL 251 >gb|EPS72528.1| peroxisomal targeting signal type 2 receptor [Genlisea aurea] Length = 314 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWD+R+ RVP AVLNGHGYAVRKVKFSPHRGS+ Sbjct: 216 VWDIRSCRVPAAVLNGHGYAVRKVKFSPHRGSV 248 >ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X1 [Glycine max] gi|571499880|ref|XP_006594554.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X2 [Glycine max] gi|571499885|ref|XP_006594555.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X3 [Glycine max] gi|571499888|ref|XP_006594556.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X4 [Glycine max] Length = 318 Score = 64.7 bits (156), Expect = 2e-08 Identities = 28/29 (96%), Positives = 28/29 (96%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPH 569 VWDVRNYRVPL VLNGHGYAVRKVKFSPH Sbjct: 220 VWDVRNYRVPLCVLNGHGYAVRKVKFSPH 248 >ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] gi|561021268|gb|ESW20039.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] Length = 318 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 VWDVRNYRVP++VLNGHGYAVRKVKFSPH +M Sbjct: 220 VWDVRNYRVPVSVLNGHGYAVRKVKFSPHVRNM 252 >gb|AAL27434.1|AF430070_1 peroxisomal targeting signal 2 receptor [Gossypium hirsutum] Length = 317 Score = 63.9 bits (154), Expect = 4e-08 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -3 Query: 655 VWDVRNYRVPLAVLNGHGYAVRKVKFSPHRGSM 557 +WDVRNYRVP++VLNGHGYAVRK KFSPHR ++ Sbjct: 219 IWDVRNYRVPVSVLNGHGYAVRKFKFSPHRRNL 251