BLASTX nr result
ID: Mentha22_contig00035009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00035009 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40485.1| hypothetical protein MIMGU_mgv1a021713mg, partial... 69 7e-10 gb|EXB40427.1| hypothetical protein L484_013730 [Morus notabilis] 61 2e-07 >gb|EYU40485.1| hypothetical protein MIMGU_mgv1a021713mg, partial [Mimulus guttatus] Length = 155 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 1 KVTSELRRKLLRSDNVGLPQTFRYDSFNYAKNFDNG 108 KVTS+LRRKL+ SDNVGLPQTFRYDSFNY+KNFD+G Sbjct: 110 KVTSQLRRKLVGSDNVGLPQTFRYDSFNYSKNFDDG 145 >gb|EXB40427.1| hypothetical protein L484_013730 [Morus notabilis] Length = 158 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +1 Query: 1 KVTSELRRKLLRSDNVGLPQTFRYDSFNYAKNFDNGRSS 117 KV SELR KL+RSD VGLPQT RYDSFNY+KNFD+GR + Sbjct: 117 KVRSELR-KLVRSDRVGLPQTCRYDSFNYSKNFDDGRKT 154