BLASTX nr result
ID: Mentha22_contig00034346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034346 (369 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33558.1| hypothetical protein MIMGU_mgv1a000433mg [Mimulus... 65 1e-08 gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Mimulus... 59 9e-07 >gb|EYU33558.1| hypothetical protein MIMGU_mgv1a000433mg [Mimulus guttatus] Length = 1157 Score = 64.7 bits (156), Expect = 1e-08 Identities = 45/102 (44%), Positives = 61/102 (59%), Gaps = 4/102 (3%) Frame = +1 Query: 1 ENEKPRDTPPALPLR--AVSRSRLPSAKRRLPVSSEADGIR--KSLEFCSFRGKMRGHGG 168 ENE P+D PPALP R SR+RLPS KRRLP S E D R +S CS + G Sbjct: 26 ENEMPKDMPPALPPRPKPTSRARLPSTKRRLP-SLEDDESRAARSSSDCS----LEGERV 80 Query: 169 DSFRDEKDREMESGEWFYVAETSDETRMEESAPNQMSYFVEK 294 +F ++ +EME+GE YV S+E+R ++ ++ YF+EK Sbjct: 81 RTFGPKRVKEMEAGESPYVVAGSNESRWDD----KLGYFIEK 118 >gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Mimulus guttatus] Length = 1199 Score = 58.5 bits (140), Expect = 9e-07 Identities = 38/86 (44%), Positives = 48/86 (55%), Gaps = 5/86 (5%) Frame = +1 Query: 1 ENEKPRDTPPALPL--RAVSRSRLPSAKRRLPVSS---EADGIRKSLEFCSFRGKMRGHG 165 +NEKP+D PPALP R+ SR+RLPS KR LP SS E D S + + +G Sbjct: 26 DNEKPKDMPPALPARPRSTSRARLPSTKRPLPTSSGIGEPDTAESSSNSNVDKEERKGLR 85 Query: 166 GDSFRDEKDREMESGEWFYVAETSDE 243 +SF + REM+ GE Y SDE Sbjct: 86 RNSFGSKNVREMKPGESPYQMAASDE 111