BLASTX nr result
ID: Mentha22_contig00034309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034309 (372 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20725.1| hypothetical protein MIMGU_mgv1a003871mg [Mimulus... 57 2e-06 >gb|EYU20725.1| hypothetical protein MIMGU_mgv1a003871mg [Mimulus guttatus] Length = 558 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 13 KLKQRDLLPLFAESMKMQHPXXXXXXXXXXXXX---QTKRVDPTSYSGQISHDSEDSKS 180 ++KQR+LLPLF E+ + P +TKRVDPTSYSG+ISHDSEDSKS Sbjct: 315 RVKQRELLPLFDENTDTKFPNLLDDGGEEGLIEYKLETKRVDPTSYSGKISHDSEDSKS 373