BLASTX nr result
ID: Mentha22_contig00034246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034246 (346 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41921.1| hypothetical protein MIMGU_mgv1a001363mg [Mimulus... 62 8e-08 ref|XP_006366337.1| PREDICTED: AMP deaminase-like [Solanum tuber... 59 9e-07 ref|XP_004246317.1| PREDICTED: AMP deaminase-like [Solanum lycop... 59 9e-07 gb|EYU26679.1| hypothetical protein MIMGU_mgv1a018519mg [Mimulus... 58 1e-06 >gb|EYU41921.1| hypothetical protein MIMGU_mgv1a001363mg [Mimulus guttatus] Length = 833 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 344 HIRLEFREMIWREEMQQVYVGKANFPNFIYP 252 HIRLEFREMIWREEMQQVY+G+ANFP FI P Sbjct: 803 HIRLEFREMIWREEMQQVYLGRANFPKFIDP 833 >ref|XP_006366337.1| PREDICTED: AMP deaminase-like [Solanum tuberosum] Length = 835 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 344 HIRLEFREMIWREEMQQVYVGKANFPNFIYP 252 HIRLEFR+MIWREEMQQVY+GKA FP+F+ P Sbjct: 805 HIRLEFRDMIWREEMQQVYLGKAVFPSFVDP 835 >ref|XP_004246317.1| PREDICTED: AMP deaminase-like [Solanum lycopersicum] Length = 832 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 344 HIRLEFREMIWREEMQQVYVGKANFPNFIYP 252 HIRLEFR+MIWREEMQQVY+GKA FP+F+ P Sbjct: 802 HIRLEFRDMIWREEMQQVYLGKAVFPSFVDP 832 >gb|EYU26679.1| hypothetical protein MIMGU_mgv1a018519mg [Mimulus guttatus] Length = 836 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 344 HIRLEFREMIWREEMQQVYVGKANFPNFIYP 252 HIRLEFR+MIWREEMQ VY+G ANFP FI P Sbjct: 806 HIRLEFRDMIWREEMQHVYLGNANFPKFIDP 836