BLASTX nr result
ID: Mentha22_contig00034133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034133 (1374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356202.1| PREDICTED: trafficking protein particle comp... 59 7e-06 >ref|XP_006356202.1| PREDICTED: trafficking protein particle complex subunit 2-like isoform X1 [Solanum tuberosum] Length = 186 Score = 58.5 bits (140), Expect = 7e-06 Identities = 33/60 (55%), Positives = 38/60 (63%), Gaps = 4/60 (6%) Frame = -1 Query: 168 TSFILVVQFLLAISRAN----LTFRPRTRSERSMASTACFMIVSKNDIPIYEAEVGTVPK 1 T+ L+ + L +S AN L R MASTACFMIVS+NDIPIYEAEVGT PK Sbjct: 19 TALCLLCELLRPVSSANSSRSLLVIELNLGIRKMASTACFMIVSRNDIPIYEAEVGTAPK 78