BLASTX nr result
ID: Mentha22_contig00034077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00034077 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33408.1| hypothetical protein MIMGU_mgv1a011171mg [Mimulus... 57 3e-06 >gb|EYU33408.1| hypothetical protein MIMGU_mgv1a011171mg [Mimulus guttatus] Length = 290 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 319 EMVFFSLLMQYAYTAEPYRTGSVSVKTEEKKKD 221 EMVFFS LMQYAYTAEPY+ GS+S K EEKKK+ Sbjct: 258 EMVFFSRLMQYAYTAEPYQKGSISEKAEEKKKE 290