BLASTX nr result
ID: Mentha22_contig00033852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033852 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41142.1| hypothetical protein MIMGU_mgv1a005331mg [Mimulus... 69 7e-10 ref|XP_002525131.1| bromodomain-containing protein, putative [Ri... 61 2e-07 >gb|EYU41142.1| hypothetical protein MIMGU_mgv1a005331mg [Mimulus guttatus] Length = 488 Score = 68.9 bits (167), Expect = 7e-10 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%) Frame = -3 Query: 301 QQPISQAMVSEGLNSMKRLHNSGIDVGAENYPGFGRDGSVARG--GFLRQ--DKVRISIS 134 + +S+ V S K + NS + + N G F+R DKVRIS+S Sbjct: 12 EDKLSERKVYSRRPSFKGIENSNLSMEQPNVEAVAMASGFDLGPDNFVRSKSDKVRISLS 71 Query: 133 KKSKHDALELRRKLESERDMVRSLMRKIESTEGIQNGFQGFDSR 2 KSK +A+ELRRKLE ERDM+RSLM KIE+ EG + + FD++ Sbjct: 72 MKSKREAVELRRKLEGERDMIRSLMTKIEADEGRRVAARKFDNQ 115 >ref|XP_002525131.1| bromodomain-containing protein, putative [Ricinus communis] gi|223535590|gb|EEF37258.1| bromodomain-containing protein, putative [Ricinus communis] Length = 742 Score = 60.8 bits (146), Expect = 2e-07 Identities = 41/92 (44%), Positives = 57/92 (61%), Gaps = 4/92 (4%) Frame = -3 Query: 301 QQPISQAMV-SEGLNSMKRLHNSGIDVGAENYPGFGRDGSVARGGFLRQ---DKVRISIS 134 QQP+S+ S+ +S+ R GA GRD + A G ++Q DKV+I+++ Sbjct: 187 QQPVSRLEANSDDSSSLNRQQ------GAAEVAPSGRDAT-AENGVVKQGLNDKVKINLA 239 Query: 133 KKSKHDALELRRKLESERDMVRSLMRKIESTE 38 KSK + ELRRKLESE DMVRSL++KIE+ E Sbjct: 240 SKSKQEMKELRRKLESELDMVRSLVKKIEAKE 271