BLASTX nr result
ID: Mentha22_contig00033764
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033764 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38155.1| hypothetical protein MIMGU_mgv1a007840mg [Mimulus... 57 3e-06 >gb|EYU38155.1| hypothetical protein MIMGU_mgv1a007840mg [Mimulus guttatus] Length = 393 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 124 ESGAEILPKEQIFSSLTQVESAIDQIREVGTNLFSGAGQV 5 E+ A+I PKEQI SS+TQVES IDQI+E+G++ FS AGQV Sbjct: 60 EARAQIFPKEQIVSSITQVESTIDQIQELGSSFFSSAGQV 99