BLASTX nr result
ID: Mentha22_contig00033608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00033608 (417 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39744.1| hypothetical protein MIMGU_mgv1a001375mg [Mimulus... 60 3e-07 >gb|EYU39744.1| hypothetical protein MIMGU_mgv1a001375mg [Mimulus guttatus] Length = 831 Score = 60.1 bits (144), Expect = 3e-07 Identities = 37/64 (57%), Positives = 42/64 (65%), Gaps = 10/64 (15%) Frame = +3 Query: 255 MAEVKPMSID---------DGVCVGKRQPKRKRLEACTYS-PSPEEKQAKILGFRNEIDS 404 MAEV+PM ID DG KRQ KRKR+E C S PSPEEK AKI FR+EIDS Sbjct: 1 MAEVEPMIIDGGDGRKPMADGPGQKKRQLKRKRVEPCLSSTPSPEEKTAKITDFRSEIDS 60 Query: 405 LVKY 416 LV++ Sbjct: 61 LVRF 64