BLASTX nr result
ID: Mentha22_contig00031733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00031733 (334 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61331.1| hypothetical protein M569_13466 [Genlisea aurea] 66 6e-09 >gb|EPS61331.1| hypothetical protein M569_13466 [Genlisea aurea] Length = 285 Score = 65.9 bits (159), Expect = 6e-09 Identities = 34/60 (56%), Positives = 39/60 (65%) Frame = +1 Query: 1 SQKGSDSSGLIDDKRCFSHEQKAKSGGGGGDNPPLSFLEKWLLDESAGQVEGVMELPPIF 180 SQKGS+ SGL+D + G D+PPLSFLEKWLLDESAG EG MELP +F Sbjct: 236 SQKGSEGSGLVDSRGKIE----------GDDHPPLSFLEKWLLDESAGHGEGAMELPSLF 285